RCN2 Antibody - BSA Free

Western Blot: RCN2 Antibody [NBP2-32010] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32010] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of human cerebral cortex.

Immunohistochemistry: RCN2 Antibody [NBP2-32010] - Staining of mouse locus coeruleus shows immunoreactivity in neurons.

Immunohistochemistry: RCN2 Antibody [NBP2-32010] - Staining of mouse red nucleus shows strong immunoreactivity in neurons.

Immunohistochemistry: RCN2 Antibody [NBP2-32010] - Staining of mouse thalamus shows positivity in neurons of the parafascicular nucleus.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of human cerebral cortex, epididymis, pancreas and testis using Anti-RCN2 antibody NBP2-32010 (A) shows similar protein distribution across tissues to independent antibody NBP2-32011 (B).

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of human pancreas.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of human testis.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of human epididymis.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RCN2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RCN2 Antibody - BSA Free (NBP2-32010) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDK
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RCN2 Protein (NBP2-32010PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RCN2 Antibody - BSA Free

• Calcium-binding protein ERC-55
• E6BPreticulocalbin 2, EF-hand calcium binding domain (endoplasmic reticulumcalcium-binding protein, 55kD)
• ERC-55
• ERC55E6-binding protein
• reticulocalbin 2, EF-hand calcium binding domain
• reticulocalbin-2
• TCBP49

Background

Reticulocalbin 2 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. The RCN2 gene maps to the same region as type 4 Bardet-Biedl syndrome (MIM:600374), suggesting a possible causative role for reticulocalbin 2 in the disorder. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCN2
• Uniprot:
  • Q14257(Human)