RCBTB2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RCBTB2 Antibody [NBP1-85636] - Staining of human cell line BJ shows localization to nucleus & the Golgi apparatus.

Immunohistochemistry-Paraffin: RCBTB2 Antibody [NBP1-85636] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RCBTB2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYG
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCBTB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RCBTB2 Protein (NBP1-85636PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RCBTB2 Antibody - BSA Free

• CHC1-L
• CHC1LRCC1-like G exchanging factor RLG
• Chromosome condensation 1-like
• RCC1 and BTB domain-containing protein 2
• RCC1-like G exchanging factor
• regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 2
• regulator of chromosome condensation and BTB domain containing protein 2
• Regulator of chromosome condensation and BTB domain-containing protein 2
• RLG

Background

RCBTB2 is a gene that codes for a protein with two isoforms, with lengths of 551 and 527 amino acids and weights of approximately 60 and 58 kDa respectively. Current research is being done on diseases and disorders related to this gene including Williams-Beuren syndrome, prostate cancer, and prostatitis. RCBTB2 has also been shown to have interactions with COPS4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCBTB2