RCAN3 Antibody

Images

 
Western Blot: RCAN3 Antibody [NBP1-84972] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: RCAN3 Antibody [NBP1-84972] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCAN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEALFTIYDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCAN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RCAN3 Protein (NBP1-84972PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RCAN3 Antibody

  • Down syndrome candidate region 1-like 2
  • Down syndrome critical region gene 1-like 2
  • DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5
  • hRCN3
  • Myocyte-enriched calcineurin-interacting protein 3
  • RCAN family member 3
  • RCN3
  • regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2
  • regulator of calcineurin 3 isoform 1b2,34,5
  • regulator of calcineurin 3 isoform 1c2,34,5
  • regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
  • Regulator of calcineurin 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-90348
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47284
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-26199
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-91745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84972
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RCAN3 Antibody (NBP1-84972) (0)

There are no publications for RCAN3 Antibody (NBP1-84972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCAN3 Antibody (NBP1-84972) (0)

There are no reviews for RCAN3 Antibody (NBP1-84972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCAN3 Antibody (NBP1-84972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCAN3 Products

Bioinformatics Tool for RCAN3 Antibody (NBP1-84972)

Discover related pathways, diseases and genes to RCAN3 Antibody (NBP1-84972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCAN3 Antibody (NBP1-84972)

Discover more about diseases related to RCAN3 Antibody (NBP1-84972).
 

Pathways for RCAN3 Antibody (NBP1-84972)

View related products by pathway.

Blogs on RCAN3

There are no specific blogs for RCAN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCAN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCAN3