RCAN3 Antibody - BSA Free

Immunohistochemistry-Paraffin: RCAN3 Antibody [NBP1-84972] - Staining in human prostate and endometrium tissues using anti-RCAN3 antibody. Corresponding RCAN3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RCAN3 Antibody [NBP1-84972] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.

Immunohistochemistry-Paraffin: RCAN3 Antibody [NBP1-84972] - Staining of human prostate shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RCAN3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEALFTIYDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCAN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RCAN3 Protein (NBP1-84972PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RCAN3 Antibody - BSA Free

• Down syndrome candidate region 1-like 2
• Down syndrome critical region gene 1-like 2
• DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5
• hRCN3
• Myocyte-enriched calcineurin-interacting protein 3
• RCAN family member 3
• RCN3
• regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2
• regulator of calcineurin 3 isoform 1b2,34,5
• regulator of calcineurin 3 isoform 1c2,34,5
• regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
• Regulator of calcineurin 3

Background

RCAN3 (RCAN family member 3), binds to the domain of calcineurin A and inhibits calcineurin-dependent transcriptional responses. It is thought that RCAN3 may have a role in central nervous system development. Disease research is currently being studied with relation to RCAN3 and Down syndrome, chronic lymphocytic leukemia, endometrial adenocarcinoma, lymphocytic leukemia, pharyngitis, Alzheimer's Disease, and adenocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCAN3