RBMS3 Antibody - BSA Free

Western Blot: RBMS3 Antibody [NBP1-57357] - OVCAR-3 cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: RBMS3 Antibody [NBP1-57357] - Human small intestine, myenteric plexus tissue at an antibody concentration of 10ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RBMS3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RBMS3(RNA binding motif, single stranded interacting protein) The peptide sequence was selected from the middle region of RBMS3. Peptide sequence PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBMS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30279231).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RBMS3 Antibody - BSA Free

• RNA binding motif, single stranded interacting protein 3
• RNA-binding protein
• single stranded interacting protein
• single-stranded-interacting protein 3

Background

RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally desc

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBMS3 Antibody (NBP1-57357)(1)

Publication using NBP1-57357

• Wu G, Cao L, Zhu J et al. Loss of RBMS3 Confers Platinum-resistance in Epithelial Ovarian Cancer via Activation of miR-126-5p/B-catenin/CBP signaling Clin. Cancer Res. 2018-10-02 [PMID: 30279231] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: RBMS3
• Uniprot:
  • Q6XE24-3(Human)