RBM25 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RBM25 Antibody [NBP2-57656] - Staining of human cell line HaCaT shows localization to nuclear speckles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM25 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBM25 Antibody - BSA Free (NBP2-57656) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM25
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM25 Recombinant Protein Antigen (NBP2-57656PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBM25 Antibody - BSA Free

• Arg/Glu/Asp-rich protein of 120 kDa
• Arg/Glu/Asp-rich protein, 120 kDa
• fSAP94
• functional spliceosome-associated protein 94
• MGC105088
• MGC117168
• NET52
• Protein S164
• RED120RNA-binding region-containing protein 7
• RNA binding motif protein 25
• RNA-binding motif protein 25
• RNA-binding protein 25
• RNA-binding region (RNP1, RRM) containing 7
• RNPC7
• S164
• Snu71
• U1 small nuclear ribonucleoprotein 1SNRP homolog

Background

RBM25, also identified as hRED120 (for human Arg/Glu/Asp-rich protein of 120 kDa), contains an RNA recognition motif and a PWI nucleic acid binding domain and is suggested to have a role in RNA processing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM25