RAX2 Antibody - Azide and BSA Free

Western Blot: RAX2 Antibody [H00084839-B01P] - Analysis of RAX2 expression in transfected 293T cell line by RAX2 polyclonal antibody. Lane 1: RAX2 transfected lysate(20.10 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAX2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RAX2 Antibody - Azide and BSA Free (H00084839-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RAX2 (NP_116142.1, 1 a.a. - 184 a.a.) full-length human protein. MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RAX2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAX2 Antibody - Azide and BSA Free

• CORD11
• MGC15631
• QRXQ50-type retinal homeobox protein
• RAXL1ARMD6
• retina and anterior neural fold homeobox 2
• retina and anterior neural fold homeobox like 1
• retina and anterior neural fold homeobox protein 2
• Retina and anterior neural fold homeobox-like protein 1

Background

This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epithelium and within the Bruch's membrane. Defects in this gene can also cause cone-rod dystrophy type 11, a disease characterized by the initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed by the degeneration of rod photoreceptor cells, which progresses to night blindness and the loss of peripheral vision. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAX2
• Uniprot:
  • NP_116142.1(Human)