RASL10B Antibody

Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining in human skeletal muscle and tonsil tissues using anti-RASL10B antibody. Corresponding RASL10B RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RASL10B Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDL
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASL10B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RASL10B Protein (NBP2-13205PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25314065).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RASL10B Antibody

• MGC47540
• Ras-like protein VTS58635
• RAS-like, family 10, member B
• Ras-related protein 17
• RRP17ras-like protein family member 10B
• VTS58635

Background

RASL10B( AAH41133, 1 a.a. - 204 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RASL10B Antibody (NBP2-13205)(1)

Publication using NBP2-13205

• A Inoue, K Okamoto, Y Fujino et al. B-RAF mutation and accumulated gene methylation in aberrant crypt foci (ACF), sessile serrated adenoma/polyp (SSA/P) and cancer in SSA/P. British Journal of Cancer 2014-10-14 [PMID: 25314065] (IHC, Human)

Bioinformatics

• Gene Symbol: RASL10B