RASL10B Antibody

Images

 
Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASL10B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGT SETPIIIVGNKRDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASL10B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RASL10B Protein (NBP2-13205PEP)
Publications
Read Publication using
NBP2-13205 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25314065).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASL10B Antibody

  • MGC47540
  • Ras-like protein VTS58635
  • RAS-like, family 10, member B
  • Ras-related protein 17
  • RRP17ras-like protein family member 10B
  • VTS58635

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-88212
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
NBP1-91746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71703
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006444-M01-100ug
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
6514-SL
Species: Hu
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77086
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5098
Species: Hu, Mu, Rt
Applications: WB
NBP2-48514
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-13205
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RASL10B Antibody (NBP2-13205)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RASL10B Antibody (NBP2-13205) (0)

There are no reviews for RASL10B Antibody (NBP2-13205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RASL10B Antibody (NBP2-13205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASL10B Products

Bioinformatics Tool for RASL10B Antibody (NBP2-13205)

Discover related pathways, diseases and genes to RASL10B Antibody (NBP2-13205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASL10B Antibody (NBP2-13205)

Discover more about diseases related to RASL10B Antibody (NBP2-13205).
 

Pathways for RASL10B Antibody (NBP2-13205)

View related products by pathway.

Research Areas for RASL10B Antibody (NBP2-13205)

Find related products by research area.

Blogs on RASL10B

There are no specific blogs for RASL10B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASL10B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASL10B