Calcyphosine Antibody

Immunohistochemistry-Paraffin: Calcyphosine Antibody [NBP1-91746] - Staining in human fallopian tube and colon tissues using anti-CAPS antibody. Corresponding CAPS RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Calcyphosine Antibody [NBP1-91746] - Staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Calcyphosine Antibody [NBP1-91746] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: Calcyphosine Antibody [NBP1-91746] - Staining of human fallopian tube shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Calcyphosine Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Calcyphosine Protein (NBP1-91746PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calcyphosine Antibody

• calcyphosin
• calcyphosine 1
• Calcyphosine
• CAPS1
• MGC126562
• thyroid protein p24

Background

Calcyphosine encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calcyphosine Antibody (NBP1-91746)(2)

Publications using NBP1-91746

• Gillen AE, Riemondy KA, Amani V et al. Single-Cell RNA Sequencing of Childhood Ependymoma Reveals Neoplastic Cell Subpopulations That Impact Molecular Classification and Etiology Cell Rep 2020-08-11 [PMID: 32783945]
• Amani V, Donson A M et al. Characterization of 2 Novel Ependymoma Cell Lines With Chromosome 1q Gain Derived From Posterior Fossa Tumors of Childhood. J Neuropathol Exp Neurol 2017-01-07 [PMID: 28863455] (IHC, Human)

Bioinformatics

• Gene Symbol: CAPS