Calcyphosine Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Calcyphosine Antibody [NBP1-91746] - Staining in human fallopian tube and colon tissues using anti-CAPS antibody. Corresponding CAPS RNA-seq data are ...read more
Immunocytochemistry/ Immunofluorescence: Calcyphosine Antibody [NBP1-91746] - Staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Calcyphosine Antibody [NBP1-91746] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Calcyphosine Antibody [NBP1-91746] - Staining of human fallopian tube shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Calcyphosine Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAPS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calcyphosine Protein (NBP1-91746PEP)
Publications
Read Publications using
NBP1-91746 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calcyphosine Antibody

  • calcyphosin
  • calcyphosine 1
  • Calcyphosine
  • CAPS1
  • MGC126562
  • thyroid protein p24

Background

Calcyphosine encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calcyphosine Antibody (NBP1-91746)(3)

Reviews for Calcyphosine Antibody (NBP1-91746) (0)

There are no reviews for Calcyphosine Antibody (NBP1-91746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Calcyphosine Antibody (NBP1-91746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calcyphosine Products

Research Areas for Calcyphosine Antibody (NBP1-91746)

Find related products by research area.

Blogs on Calcyphosine

There are no specific blogs for Calcyphosine, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcyphosine Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPS