NBR1 Antibody (6B11)

Images

 
Western Blot: NBR1 Antibody (6B11) [H00004077-M01] - Western Blot analysis of NBR1 expression in PC-12
ELISA: NBR1 Antibody (6B11) [H00004077-M01] - Detection limit for recombinant GST tagged NBR1 is approximately 0.1 ng/mL as a capture antibody.
Simple Western: NBR1 Antibody (6B11) [H00004077-M01] - This antibody (1:25 dilution) was used to probe THP-1 macrophage lysate (concentrations shown) by Simple Western. Results from two hybridoma clones are shown. ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, ELISA, EM, ICC/IF, S-ELISA
Clone
6B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NBR1 Antibody (6B11) Summary

Immunogen
NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Specificity
NBR1 - neighbor of BRCA1 gene 1 (6B11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NBR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Simple Western
  • Electron Microscopy
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 24664425). Use in Electron microscopy reported in scientific literature (PMID: 24664425). This NBR1 Antibody (6B11) is validated for Simple Western from a verified customer review.
Reviewed Applications
Read 1 Review rated 3
using
H00004077-M01 in the following applications:

Publications
Read Publications using
H00004077-M01 in the following applications:

  • EM
    1 publication
  • 1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 23804102). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NBR1 Antibody (6B11)

  • Cell migration-inducing gene 19 protein
  • FLJ98272
  • KIAA0049CA125
  • M17S2FLJ55359,1A1-3B
  • Membrane component chromosome 17 surface marker 2,1A13B
  • membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125)
  • migration-inducing protein 19
  • Neighbor of BRCA1 gene 1 protein
  • neighbor of BRCA1 gene 1
  • next to BRCA1 gene 1 protein
  • Protein 1A1-3B

Background

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-1468
Species: Hu
Applications: WB, IHC, IHC-P, S-ELISA
NBP1-41185
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
H00010230-P01
Species: Hu
AF3256
Species: Hu
Applications: WB
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, I, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
H00005607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-31207
Species: Hu, Mu, Rt, Po, Sq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-79833
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-82090
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-33691
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46224
Species: Hu
Applications: WB, IHC
H00004077-M01
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, EM, ICC/IF, S-ELISA

Publications for NBR1 Antibody (H00004077-M01)(12)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: EM, ICC/IF, WB.


Filter By Application
EM
(1)
ICC/IF
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using H00004077-M01 Applications Species
Park S, Zuber C, Roth J Selective autophagy of cytosolic protein aggregates involves ribosome-free rough endoplasmic reticulum Histochem. Cell Biol. Nov 12 2019 [PMID: 31720797]
Cai J, Pires KM, Ferhat M et al. Autophagy Ablation in Adipocytes Induces Insulin Resistance and Reveals Roles for Lipid Peroxide and Nrf2 Signaling in Adipose-Liver Crosstalk. Cell Rep Nov 13 2018 [PMID: 30428342]
Jiang L, Hara-Kuge S, Yamashita SI, Fujiki Y. Peroxin Pex14p is the key component for coordinated autophagic degradation of mammalian peroxisomes by direct binding to LC3-II. Genes Cells. 2014 Oct 31 [PMID: 25358256]
Dowdle WE, Nyfeler B, Nagel J et al. Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo. Nat Cell Biol. 2014 Oct 19 [PMID: 25327288]
Nicot AS, Lo Verso F, Ratti F et al. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy. 2014 Jun [PMID: 24879152]
Park S, Jang I, Zuber C et al. ERADication of EDEM1 occurs by selective autophagy and requires deglycosylation by cytoplasmic peptide N-glycanase. Histochem. Cell Biol. 3/25/2014 [PMID: 24664425] (WB, ICC/IF, EM, Human) WB, ICC/IF, EM Human
Micsenyi MC, Sikora J, Stephney G et al. Lysosomal membrane permeability stimulates protein aggregate formation in neurons of a lysosomal disease. J Neurosci 2013 Jun 26 [PMID: 23804102] (WB, Mouse) WB Mouse
Rue L, Lopez-Soop G, Gelpi E et al. Brain region- and age-dependent dysregulation of p62 and NBR1 in a mouse model of Huntington's disease. Neurobiol Dis. 2013 Jan 04 [PMID: 23295856]
Deosaran E, Larsen KB, Hua R et al. NBR1 acts as an autophagy receptor for peroxisomes. J Cell Sci. 2012 Dec 13 [PMID: 23239026]
Wong E, Bejarano E, Rakshit M et al. Molecular determinants of selective clearance of protein inclusions by autophagy. Nat Commun. 2012 Dec 04 [PMID: 23212369]
Show All 12 Publications.

Review for NBR1 Antibody (H00004077-M01) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00004077-M01:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western NBR1 H00004077-M01
Enlarge
reviewed by:
Anonymous
Simple Western Human 12/05/2019
View

Summary

ApplicationSimple Western
Sample TestedTHP-1 macrophage lysate
SpeciesHuman
LotJ9231-6B11

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NBR1 Antibody (H00004077-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NBR1 Products

Bioinformatics Tool for NBR1 Antibody (H00004077-M01)

Discover related pathways, diseases and genes to NBR1 Antibody (H00004077-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NBR1 Antibody (H00004077-M01)

Discover more about diseases related to NBR1 Antibody (H00004077-M01).
 

Pathways for NBR1 Antibody (H00004077-M01)

View related products by pathway.

PTMs for NBR1 Antibody (H00004077-M01)

Learn more about PTMs related to NBR1 Antibody (H00004077-M01).

Blogs on NBR1.

Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles
By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox...  Read full blog post.

Monitoring Autophagy in Neurons
By Christina Towers, PhD. Autophagy is a critical cellular process used by most cells in the body to recycle nutrients and prevent harmful buildup of damaged proteins. It is particularly important in the brain, where...  Read full blog post.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants; LC3A, LC3B and LC3C (He et al., 2003). LC3B is a subunit of the MAP1A and MAP1B microtubule-binding pr...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
12/05/2019
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol NBR1
Entrez
Uniprot