RARRES3 Antibody (1H5)

Images

 
Western Blot: RARRES3 Antibody (1H5) [H00005920-M10] - Analysis of RARRES3 expression in transfected 293T cell line by RARRES3 monoclonal antibody (M10), clone 1H5. Lane 1: RARRES3 transfected lysatE (18.2 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RARRES3 Antibody (1H5) Summary

Immunogen
RARRES3 (AAH09678, 1 a.a. - 164 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Specificity
RARRES3 - retinoic acid receptor responder (tazarotene induced) 3 (1H5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RARRES3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RARRES3 Antibody (1H5)

  • HRASLS4
  • PLA1/2-3
  • RARRES3
  • RAR-responsive protein TIG3
  • retinoic acid receptor responder (tazarotene induced) 3
  • retinoic acid receptor responder protein 3
  • retinoic acid-inducible gene 1
  • Retinoid-inducible gene 1 protein
  • RIG1
  • Tazarotene-induced gene 3 protein
  • TIG3
  • TIG3MGC8906

Background

Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46429
Species: Hu
Applications: WB, IHC, IF
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3155
Species: Mu
Applications: WB, IHC
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
H00005920-M10
Species: Hu
Applications: WB, ELISA

Publications for RARRES3 Antibody (H00005920-M10) (0)

There are no publications for RARRES3 Antibody (H00005920-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RARRES3 Antibody (H00005920-M10) (0)

There are no reviews for RARRES3 Antibody (H00005920-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RARRES3 Antibody (H00005920-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RARRES3 Products

Bioinformatics Tool for RARRES3 Antibody (H00005920-M10)

Discover related pathways, diseases and genes to RARRES3 Antibody (H00005920-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RARRES3 Antibody (H00005920-M10)

Discover more about diseases related to RARRES3 Antibody (H00005920-M10).
 

Pathways for RARRES3 Antibody (H00005920-M10)

View related products by pathway.

PTMs for RARRES3 Antibody (H00005920-M10)

Learn more about PTMs related to RARRES3 Antibody (H00005920-M10).
 

Research Areas for RARRES3 Antibody (H00005920-M10)

Find related products by research area.

Blogs on RARRES3

There are no specific blogs for RARRES3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RARRES3 Antibody (1H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol RARRES3
Entrez
Uniprot