RAP6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RAP6 Antibody [NBP3-35722] - Immunofluorescence analysis of L929 cells using RAP6 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: RAP6 Antibody [NBP3-35722] - Western blot analysis of various lysates using RAP6 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAP6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAP6 Antibody - BSA Free (NBP3-35722) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RAP6 (NP_056450.2).
  
  Sequence:
  MVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLIITSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLSRLRENPRLIASSLVAGEKLNQENTQSVIYTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSILFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQEKLFGEKGSDRFRQKVQEMVESNEAKLVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAPVD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 165 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RAP6 Antibody - BSA Free

• DKFZP434C212
• GAPex-5
• GAPEX5RAP6Rab5-activating protein 6
• GTPase activating protein and VPS9 domains 1
• GTPase-activating protein and VPS9 domain-containing protein 1
• KIAA1521MGC138848
• MGC138847

Background

GAPex-5 was identified in a two-hybrid screen for interactors of CIP4 (Cdc42 interacting protein 4). GAPex-5 contains a Ras-GAP domain and a VPS9 (vacuolar sorting protein 9 (VPS9) domain. It functions as a GEF for RAB31 to influence GLUT4 trafficking. It has also been found to be involved in the trafficking and ubiquitination of EGFR. Alternate names for GAPex-5 include GTPase-activating protein and VPS9 domain-containing protein 1, Rab5-activating protein 6, GAPVD1, GAPEX5, RAP6, and KIAA1521.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAPVD1