RAP6 Antibody

Images

 
Western Blot: RAP6 Antibody [NBP1-85137] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RAP6 Antibody [NBP1-85137] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: RAP6 Antibody [NBP1-85137] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAPVD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAP6 Protein (NBP1-85137PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAP6 Antibody

  • DKFZP434C212
  • GAPex-5
  • GAPEX5RAP6Rab5-activating protein 6
  • GTPase activating protein and VPS9 domains 1
  • GTPase-activating protein and VPS9 domain-containing protein 1
  • KIAA1521MGC138848
  • MGC138847

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00023433-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-410
Species: Hu, Mu
Applications: WB, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-50030
Species: Hu
Applications: WB, IP

Publications for RAP6 Antibody (NBP1-85137) (0)

There are no publications for RAP6 Antibody (NBP1-85137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAP6 Antibody (NBP1-85137) (0)

There are no reviews for RAP6 Antibody (NBP1-85137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAP6 Antibody (NBP1-85137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAP6 Products

Bioinformatics Tool for RAP6 Antibody (NBP1-85137)

Discover related pathways, diseases and genes to RAP6 Antibody (NBP1-85137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAP6 Antibody (NBP1-85137)

Discover more about diseases related to RAP6 Antibody (NBP1-85137).

Blogs on RAP6

There are no specific blogs for RAP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAPVD1