Home » RANBP9 » RANBP9 Antibodies » RANBP9 Antibody

RANBP9 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RANBP9 Antibody [NBP2-85594] - Host: Rabbit. Target Name: RANB9. Sample Type: Lung Tumor lysates. Antibody Dilution: 1.0ug/ml
Western Blot: RANBP9 Antibody [NBP2-85594] - Host: Rabbit. Target Name: RANB9. Sample Type: Lung Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RANBP9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RANB9. Peptide sequence: LNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RANBP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RANBP9 Antibody

  • BPM90
  • BPM-L
  • RAN binding protein 9
  • Ran Binding Protein in the Microtubule organizing center
  • ran binding protein, centrosomal
  • ran-binding protein 9
  • Ran-binding protein M
  • RanBP7
  • RanBP9
  • RanBPM
  • RANBPMnovel centrosomal protein RanBPM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ran Antibody
(8D1A6) - BSA Free
NBP2-61832
ELISA: Ran Antibody (8D1A6) [NBP2-61832] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: Ran Antibody (8D1A6) [NBP2-61832] - Analysis of Hela cells using RAN mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: Ran Antibody (8D1A6) [NBP2-61832] - Analysis of GC-7901 cells using RAN mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
HGF [Unconjugated]
294-HG/CF
Measured by its ability to induce IL-11 secretion by Saos‑2 human osteosarcoma cells. The ED50 for this effect is 0.1‑0.5 ng/mL.
(99 Publications)
Species: Hu
Applications: BA
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Environmental novelty exacerbates stress hormones and Aβ pathology in an Alzheimer's model. Sci Rep (2017)
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(48 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Mkln1 Antibody
NBP1-80655
Immunohistochemistry-Paraffin: Mkln1 Antibody [NBP1-80655] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RANBP10 Antibody -
BSA Free
NBP1-77372
Immunocytochemistry/Immunofluorescence: RANBP10 Antibody [NBP1-77372] - Immunofluorescence of RANBP10 in mouse skeletal muscle tissue with RANBP10 antibody at 20 ug/mL.
Western Blot: RANBP10 Antibody [NBP1-77372] - Human skeletal muscle tissue lysate with RANBP10 antibody at (A) 1 and (B) 2 ug/mL.
Immunohistochemistry-Paraffin: RANBP10 Antibody [NBP1-77372] - Human skeletal muscle tissue with RANBP10 antibody at 5 ug/mL.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(39 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human skin tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Species: Hu
Applications: IHC, IHC-P
BDNF [HRP]
DBD00
(4 Reviews)
(79 Publications)
Species: Hu
Applications: ELISA
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: ICC/IF, WB
RNMT Antibody
NBP2-97644
Immunocytochemistry/Immunofluorescence: RNMT Antibody [NBP2-97644] - Immunofluorescence staining of RNMT in U2OS cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human RNMT polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green). Positive staining was localized to Nucleus.
Western Blot: RNMT Antibody [NBP2-97644] - Anti-RNMT rabbit polyclonal antibody at 1:500 dilution. Lane A: Hela Whole Cell Lysate Lane B: HEK-293 Whole Cell Lysate Lane C: 293T Whole Cell Lysate Lane D: Jurkat Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 55 kDa. Observed band size: 57 kDa
Immunoprecipitation: RNMT Antibody [NBP2-97644] - RNMT was immunoprecipitated using: Lane A: 0.5 mg Jurkat Whole Cell Lysate 4 ul anti-RNMT rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein A/G. Primary antibody: Anti-RNMT rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 55 kDa. Observed band size: 60 kDa
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB (-), WB
MVP Antibody
NBP1-33560
Immunocytochemistry/Immunofluorescence: MVP Antibody [NBP1-33560] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: MVP Antibody [NBP1-33560] - A549 xenograft, using LRP(MVP) antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: MVP Antibody [NBP1-33560] - Sample (30 ug of whole cell lysate) A: Molt-4 7.5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
IL-6 [HRP]
D6050
(32 Reviews)
(643 Publications)
Species: Hu
Applications: ELISA
BACE-1 Antibody
(137612)
MAB931
Western blot shows lysates of human brain (Alzheimer's disease hippocampus) tissue. PVDF Membrane was probed with 2 µg/mL of Mouse Anti-Human/Mouse BACE‑1 Ectodomain Monoclonal Antibody (Catalog # MAB931) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for BACE‑1 at approximately 60 and 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
HGFR/c-MET
Antibody [Unconjugate
AF276
HGF R/c‑MET was detected in immersion fixed HT‑29 human colon adenocarcinoma cell line (positive control, left panel) and U937 human histiocytic lymphoma cell line (negative control, right panel) using Goat Anti-Human HGF R/c‑MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF276) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HGF R/c-MET was detected in immersion fixed paraffin-embedded sections of human skin using 15 µg/mL Goat Anti-Human HGF R/c-MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF276) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HGF R/c-Met knockout HeLa cell line (KO). PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HGF R/c‑MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF276) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for HGF R/c‑MET at approximately 150-200 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(24 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, WB
Ryanodine Receptor
2 Antibody
NBP2-76961
Dot Blot: Ryanodine Receptor 2 Antibody [NBP2-76961] - Dot blot analysis of anti-RYR2 immunization peptide on PVDF. 1ug, 2ug and 4ug peptides were given in this test. Anti-RYR2 antibody was diluted with 1/500.
Immunocytochemistry/Immunofluorescence: Ryanodine Receptor 2 Antibody [NBP2-76961] - ICC staining RYR2 in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Ryanodine Receptor 2 Antibody [NBP2-76961] - ICC staining RYR2 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P, WB
Dyrk1B Antibody
NBP1-33464
Immunocytochemistry/Immunofluorescence: Dyrk1B Antibody [NBP1-33464] - Paraformaldehyde-fixed HeLa, using DYRK1B antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Western Blot: Dyrk1B Antibody [NBP1-33464] - Sample (50 ug of whole cell lysate) A: mouse liver 7. 5% SDS PAGE, antibody diluted at 1:500.
Western Blot: Dyrk1B Antibody [NBP1-33464] - Sample (30 ug of whole cell lysate) A: H1299 7. 5% SDS PAGE; antibody diluted at 1:1000.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB
Ryanodine Receptor
Antibody (34C) - BSA ...
NB300-543
Immunohistochemistry-Paraffin: Ryanodine Receptor Antibody (34C) [NB300-543] - Biopsies of deparaffinized Human skeletal muscle tissue.
(12 Publications)
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for RANBP9 Antibody (NBP2-85594) (0)

There are no publications for RANBP9 Antibody (NBP2-85594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RANBP9 Antibody (NBP2-85594) (0)

There are no reviews for RANBP9 Antibody (NBP2-85594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RANBP9 Antibody (NBP2-85594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RANBP9 Products

Bioinformatics Tool for RANBP9 Antibody (NBP2-85594)

Discover related pathways, diseases and genes to RANBP9 Antibody (NBP2-85594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RANBP9 Antibody (NBP2-85594)

Discover more about diseases related to RANBP9 Antibody (NBP2-85594).
 

Pathways for RANBP9 Antibody (NBP2-85594)

View related products by pathway.

PTMs for RANBP9 Antibody (NBP2-85594)

Learn more about PTMs related to RANBP9 Antibody (NBP2-85594).
 

Research Areas for RANBP9 Antibody (NBP2-85594)

Find related products by research area.

Blogs on RANBP9.

Check out the latest blog posts on RANBP9.
CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1)
CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD ...  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RANBP9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RANBP9