RALY Antibody


Western Blot: RALY Antibody [NBP2-13201] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-RALY antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: RALY Antibody [NBP2-13201] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining in human testis and liver tissues using anti-RALY antibody. Corresponding RALY RNA-seq data are presented for the same tissues.
Western Blot: RALY Antibody [NBP2-13201] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: RALY Antibody [NBP2-13201] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD

Order Details

RALY Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTT SSAKIKLKSSELQAIK
Specificity of human RALY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RALY Protein (NBP2-13201PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RALY Antibody

  • Autoantigen p542
  • Heterogeneous nuclear ribonucleoprotein C-like 2
  • hnRNP associated with lethal yellow protein homolog
  • hnRNP core protein C-like 2
  • HNRPCL2MGC117312
  • P542hnRNP-associated with lethal yellow)
  • RNA binding protein (autoantigenic, hnRNP-associated with lethal yellow)
  • RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog(mouse))
  • RNA-binding protein (autoantigenic)
  • RNA-binding protein Raly


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for RALY Antibody (NBP2-13201) (0)

There are no publications for RALY Antibody (NBP2-13201).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALY Antibody (NBP2-13201) (0)

There are no reviews for RALY Antibody (NBP2-13201). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RALY Antibody (NBP2-13201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RALY Antibody and receive a gift card or discount.


Gene Symbol RALY