RALY Antibody - BSA Free

Western Blot: RALY Antibody [NBP2-13201] - Analysis using Anti-RALY antibody NBP2-13201 (A) shows similar pattern to independent antibody NBP2-13200 (B).

Immunocytochemistry/Immunofluorescence: RALY Antibody [NBP2-13201] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human colon.

Western Blot: RALY Antibody [NBP2-13201] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Western Blot: RALY Antibody [NBP2-13201] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-RALY antibody. Remaining relative intensity is presented.

Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.

Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining in human testis and liver tissues using anti-RALY antibody. Corresponding RALY RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human colon, liver, lymph node and testis using Anti-RALY antibody NBP2-13201 (A) shows similar protein distribution across tissues to independent antibody NBP2-13200 (B).

Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human lymph node.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Analysis in human testis and liver tissues using Anti-RALY antibody. Corresponding RALY RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RALY Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RALY Antibody - BSA Free (NBP2-13201) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RALY
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RALY Protein (NBP2-13201PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RALY Antibody - BSA Free

• Autoantigen p542
• Heterogeneous nuclear ribonucleoprotein C-like 2
• hnRNP associated with lethal yellow protein homolog
• hnRNP core protein C-like 2
• HNRPCL2MGC117312
• P542hnRNP-associated with lethal yellow)
• RNA binding protein (autoantigenic, hnRNP-associated with lethal yellow)
• RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog(mouse))
• RNA-binding protein (autoantigenic)
• RNA-binding protein Raly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RALY