ZFAND5 Antibody - BSA Free

Western Blot: ZFAND5 Antibody [NBP1-80609] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ZFAND5 Antibody [NBP1-80609] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ZFAND5 Antibody [NBP1-80609] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ZFAND5 Antibody [NBP1-80609] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: ZFAND5 Antibody [NBP1-80609] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neurons.

Immunohistochemistry-Paraffin: ZFAND5 Antibody [NBP1-80609] -Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZFAND5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKK
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFAND5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZFAND5 Protein (NBP1-80609PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZFAND5 Antibody - BSA Free

• Zinc finger A20 domain-containing protein 2
• Zinc finger protein 216ZA20D2
• zinc finger, AN1-type domain 5
• ZNF216A20 domain containing 2

Background

ZFAND5 inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apopt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZFAND5 Antibody (NBP1-80609)(3)

Publications using NBP1-80609

• Abe H, Yeh YH, Munakata Y et al. Active DNA damage response signaling initiates and maintains meiotic sex chromosome inactivation Nature communications 2022-11-28 [PMID: 36443288] (ICC/IF, Mouse)
• Matsumura T, Totani H, Gunji Y et al. A Myb enhancer-guided analysis of basophil and mast cell differentiation Nature communications 2022-11-18 [PMID: 36400777] (ICC/IF, Mouse)
• Liu P, Wang Y, Duan L. ZFAND5 Is an Independent Prognostic Biomarker of Perihilar Cholangiocarcinoma Frontiers in Oncology 2022-07-13 [PMID: 35912230] (Immunohistochemistry)

Bioinformatics

• Gene Symbol: ZFAND5
• Entrez:
  • 7763(Human)