Radixin Antibody

Images

 
Western Blot: Radixin Antibody [NBP1-85238] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Radixin Antibody [NBP1-85238] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Radixin Antibody [NBP1-85238] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Radixin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RDX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Radixin Protein (NBP1-85238PEP)
Publications
Read Publication using NBP1-85238.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Radixin Antibody

  • deafness, autosomal recessive 24
  • DFNB24
  • radixin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32748
Species: Hu, Po
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBL1-10259
Species: Hu
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western

Publications for Radixin Antibody (NBP1-85238)(1)

Reviews for Radixin Antibody (NBP1-85238) (0)

There are no reviews for Radixin Antibody (NBP1-85238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Radixin Antibody (NBP1-85238). (Showing 1 - 1 of 1 FAQ).

  1. Has Radixin Antibody (NBP1-85238) been tested for use in mouse for IF?
    • We have not yet tested our NBP1-85238 with mouse samples. I have performed a sequence alignment and the human and mouse sequences are very close. I would anticipate that this antibody would be able to detect the mouse protein. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Secondary Antibodies

 

Isotype Controls

Additional Radixin Products

Bioinformatics Tool for Radixin Antibody (NBP1-85238)

Discover related pathways, diseases and genes to Radixin Antibody (NBP1-85238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Radixin Antibody (NBP1-85238)

Discover more about diseases related to Radixin Antibody (NBP1-85238).
 

Pathways for Radixin Antibody (NBP1-85238)

View related products by pathway.

PTMs for Radixin Antibody (NBP1-85238)

Learn more about PTMs related to Radixin Antibody (NBP1-85238).

Blogs on Radixin

There are no specific blogs for Radixin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Radixin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RDX