RAD52 Antibody

Images

 
Western Blot: RAD52 Antibody [NBP2-85584] - Host: Rabbit. Target Name: RAD52. Sample Tissue: Human OVCAR-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAD52 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAD52. Peptide sequence: LNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RAD52
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAD52 Antibody

  • DNA repair protein RAD52 homolog
  • RAD52 (S. cerevisiae) homolog
  • RAD52 homolog (S. cerevisiae)
  • recombination protein RAD52
  • rhabdomyosarcoma antigen MU-RMS-40.23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-27500
Species: Mu
Applications: KO, PEP-ELISA, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00005810-M01J
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, ELISA(Cap), S-ELISA, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-508
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NB120-13600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00056852-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-33916
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-58233
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB

Publications for RAD52 Antibody (NBP2-85584) (0)

There are no publications for RAD52 Antibody (NBP2-85584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD52 Antibody (NBP2-85584) (0)

There are no reviews for RAD52 Antibody (NBP2-85584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAD52 Antibody (NBP2-85584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAD52 Products

Array NBP2-85584

Bioinformatics Tool for RAD52 Antibody (NBP2-85584)

Discover related pathways, diseases and genes to RAD52 Antibody (NBP2-85584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD52 Antibody (NBP2-85584)

Discover more about diseases related to RAD52 Antibody (NBP2-85584).
 

Pathways for RAD52 Antibody (NBP2-85584)

View related products by pathway.

PTMs for RAD52 Antibody (NBP2-85584)

Learn more about PTMs related to RAD52 Antibody (NBP2-85584).
 

Research Areas for RAD52 Antibody (NBP2-85584)

Find related products by research area.

Blogs on RAD52

There are no specific blogs for RAD52, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAD52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD52