Rad17 Recombinant Protein Antigen

Images

 
There are currently no images for Rad17 Protein (NBP1-86561PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rad17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD17.

Source: E. coli

Amino Acid Sequence: SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86561.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad17 Recombinant Protein Antigen

  • CCYC
  • cell cycle checkpoint protein (RAD17)
  • cell cycle checkpoint protein RAD17
  • FLJ41520
  • HRAD17
  • R24L
  • RAD1 (S. pombe) homolog
  • RAD1 homolog
  • RAD17 homolog (S. pombe)
  • Rad17
  • Rad17-like protein
  • RAD17SP
  • RAD24
  • RF-C activator 1 homolog
  • RF-C/activator 1 homolog

Background

Signals originating from damaged DNA activate checkpoint pathways and target the mitotic apparatus via a number a distinct mechanisms. These checkpoints link damage to DNA with the components of the cell cycle through signal transduction systems. In mammals, five genes have been identified as components of DNA damage-induced checkpoint pathways: ATM, p53, p21/WAF1/CIP1, hCHK1, and 14-3-3sigma. When overexpressed in mammalian cells, hRAD17 activates p53 and causes an accumulation of G1 phase cells, suggesting an involvement of the hRAD17 gene in this checkpoint pathway.(1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00005810-M01J
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, ELISA(Cap), S-ELISA, WB
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89445
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3989
Species: Hu, Mu, Rt
Applications: WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NB100-247
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-03346
Species: Hu
Applications: IHC,  IHC-P, IP, WB

Publications for Rad17 Protein (NBP1-86561PEP) (0)

There are no publications for Rad17 Protein (NBP1-86561PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad17 Protein (NBP1-86561PEP) (0)

There are no reviews for Rad17 Protein (NBP1-86561PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rad17 Protein (NBP1-86561PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad17 Products

Research Areas for Rad17 Protein (NBP1-86561PEP)

Find related products by research area.

Blogs on Rad17

There are no specific blogs for Rad17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rad17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD17