Rab5a Antibody


Western Blot: Rab5a Antibody [NBP1-58927] - Lanes : Lane 1: Mouse C2 cell lysateLane 2: GFP-Rab5 transfected cos cellsLane 3: GFP-Rab31 transfected cos cells Primary Antibody Dilution : 1:500 Secondary Antibody : Goat ...read more
Western Blot: Rab5a Antibody [NBP1-58927] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

Rab5a Antibody Summary

Synthetic peptides corresponding to RAB5A(RAB5A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB5A. Peptide sequence SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS.
Early Endosome Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RAB5A and was validated on Western blot.
Positive Control
Rab5a Lysate (NBP2-65454)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rab5a Antibody

  • RAB5A, member RAS oncogene family
  • RAB5RAS-associated protein RAB5A
  • ras-related protein Rab-5A


RAB5A is required for the fusion of plasma membranes and early endosomes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for Rab5a Antibody (NBP1-58927) (0)

There are no publications for Rab5a Antibody (NBP1-58927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab5a Antibody (NBP1-58927) (0)

There are no reviews for Rab5a Antibody (NBP1-58927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab5a Antibody (NBP1-58927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Rab5a Products

Bioinformatics Tool for Rab5a Antibody (NBP1-58927)

Discover related pathways, diseases and genes to Rab5a Antibody (NBP1-58927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab5a Antibody (NBP1-58927)

Discover more about diseases related to Rab5a Antibody (NBP1-58927).

Pathways for Rab5a Antibody (NBP1-58927)

View related products by pathway.

PTMs for Rab5a Antibody (NBP1-58927)

Learn more about PTMs related to Rab5a Antibody (NBP1-58927).

Research Areas for Rab5a Antibody (NBP1-58927)

Find related products by research area.

Blogs on Rab5a

There are no specific blogs for Rab5a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rab5a Antibody and receive a gift card or discount.


Gene Symbol RAB5A