| Reactivity | Hu, Mu, ZeSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to RAB5A(RAB5A, member RAS oncogene family). The peptide sequence was selected from the middle region of RAB5A. Peptide sequence KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS. The peptide sequence for this immunogen was taken from within the described region. |
| Marker | Early Endosome Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB5A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-58880 | Applications | Species |
|---|---|---|
| Pera M, Larrea D, Guardia-Laguarta C et al. Increased localization of APP-C99 in mitochondria-associated ER membranes causes mitochondrial dysfunction in Alzheimer disease. EMBO J. 2017-10-10 [PMID: 29018038] (WB, Mouse) | WB | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
NIKHIL VAD |
Immunofluorescence (IF) | Human | 07/17/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Rab5a Antibody (NBP1-58880)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| NIKHIL VAD 07/17/2018 |
||
| Application: | Immunofluorescence (IF) | |
| Species: | Human |