RAB43 Antibody

Images

 
Immunohistochemistry-Paraffin: RAB43 Antibody [NBP2-49309] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry: RAB43 Antibody [NBP2-49309] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RAB43 Antibody [NBP2-49309] - Staining in human thyroid gland and skeletal muscle tissues using anti-RAB43 antibody. Corresponding RAB43 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RAB43 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAB43 Recombinant Protein Antigen (NBP2-49309PEP)

Reactivity Notes

Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB43 Antibody

  • MGC90481
  • RAB11B
  • RAB41ISY1
  • RAB43, member RAS oncogene family
  • Ras-related protein Rab-41
  • ras-related protein Rab-43

Background

RAB43 belongs to the small GTPase superfamily. Rab family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB43 Antibody (NBP2-49309) (0)

There are no publications for RAB43 Antibody (NBP2-49309).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB43 Antibody (NBP2-49309) (0)

There are no reviews for RAB43 Antibody (NBP2-49309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RAB43 Antibody (NBP2-49309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB43 Products

Research Areas for RAB43 Antibody (NBP2-49309)

Find related products by research area.

Blogs on RAB43

There are no specific blogs for RAB43, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB43