RAB43 Antibody

Images

 
Western Blot: RAB43 Antibody [H00339122-D01P] - Analysis of RAB43 expression in transfected 293T cell line by RAB43 polyclonal antibody.Lane 1: RAB43 transfected lysate(23.30 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB43 Antibody Summary

Immunogen
RAB43 (NP_940892.1, 1 a.a. - 212 a.a.) full-length human protein. MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC
Specificity
RAB43 - RAB43, member RAS oncogene family,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB43
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB43 Antibody

  • MGC90481
  • RAB11B
  • RAB41ISY1
  • RAB43, member RAS oncogene family
  • Ras-related protein Rab-41
  • ras-related protein Rab-43

Background

RAB43 belongs to the small GTPase superfamily. Rab family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB43 Antibody (H00339122-D01P) (0)

There are no publications for RAB43 Antibody (H00339122-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB43 Antibody (H00339122-D01P) (0)

There are no reviews for RAB43 Antibody (H00339122-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB43 Antibody (H00339122-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB43 Products

Research Areas for RAB43 Antibody (H00339122-D01P)

Find related products by research area.

Blogs on RAB43

There are no specific blogs for RAB43, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB43
Entrez
Uniprot