Rab4 Antibody (1E1.)

Images

 
There are currently no images for Rab4 Antibody (H00005867-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E1.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rab4 Antibody (1E1.) Summary

Immunogen
RAB4A (AAH04309, 1 a.a. - 218 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Marker
Early and Recycling Endosomes Marker
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB4A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rab4 Antibody (1E1.)

  • Oncogene RAB4
  • RAB4, member RAS oncogene family
  • RAB4A, member RAS oncogene family
  • RAB4HRES-1/RAB4
  • ras-related protein Rab-4A

Background

Rab4 is a small GTPase that regulates recycling of proteins, such as GPCRs, from the early endosomes to the cell surface. Overexpression of Rab4 causes a redistribution of receptors on plasma membrane versus endocytic compartments. Rab4 is also involved in the translocation of glucose transporter (Glu4) in adipocytes in response to insulin. Association of Rab4 with transferrin receptor containing early endosomes is mediated through the geranylgeranyl groups at its carboxyl terminus. Rab4 can be used as a marker for early endosomes (see Daro et al. 1996 and Zuk et al. 1999 for more information). Membrane association is also cell cycle dependent, as phosphorylation at its C-terminal cdc2 kinase consensus sequence in mitotic cells leads to dissociation of Rab4 into the cytosol.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83606
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-31480
Species: Hu
Applications: WB, IHC, IHC-P
H00005867-M02
Species: Hu
Applications: WB, ELISA

Publications for Rab4 Antibody (H00005867-M02) (0)

There are no publications for Rab4 Antibody (H00005867-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab4 Antibody (H00005867-M02) (0)

There are no reviews for Rab4 Antibody (H00005867-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab4 Antibody (H00005867-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rab4 Products

Bioinformatics Tool for Rab4 Antibody (H00005867-M02)

Discover related pathways, diseases and genes to Rab4 Antibody (H00005867-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab4 Antibody (H00005867-M02)

Discover more about diseases related to Rab4 Antibody (H00005867-M02).
 

Pathways for Rab4 Antibody (H00005867-M02)

View related products by pathway.

PTMs for Rab4 Antibody (H00005867-M02)

Learn more about PTMs related to Rab4 Antibody (H00005867-M02).
 

Research Areas for Rab4 Antibody (H00005867-M02)

Find related products by research area.

Blogs on Rab4

There are no specific blogs for Rab4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab4 Antibody (1E1.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB4A
Uniprot