RAB3GAP2 Antibody

Images

 
Western Blot: RAB3GAP2 Antibody [NBP2-85579] - Host: Rabbit. Target Name: RAB3GAP2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB3GAP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RAB3GAP2. Peptide sequence: SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RAB3GAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB3GAP2 Antibody

  • DKFZP434D245
  • FLJ14579
  • KIAA0839p150
  • RAB3 GTPase activating protein subunit 2 (non-catalytic)
  • Rab3 GTPase-activating protein 150 kDa subunit
  • rab3 GTPase-activating protein non-catalytic subunit
  • Rab3-GAP p150
  • Rab3-GAP regulatory subunit
  • RAB3GAP150
  • RAB3-GAP150
  • RGAP-iso

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB500-328
Species: Hu
Applications: CyTOF-ready, Flow, IP
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF1008
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NB110-97871
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
796-IC
Species: Mu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-43567
Species: Hu, Mu
Applications: ICC/IF, KO, WB
NBP1-88829
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88840
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP2-61144
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-85579
Species: Hu
Applications: WB

Publications for RAB3GAP2 Antibody (NBP2-85579) (0)

There are no publications for RAB3GAP2 Antibody (NBP2-85579).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB3GAP2 Antibody (NBP2-85579) (0)

There are no reviews for RAB3GAP2 Antibody (NBP2-85579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB3GAP2 Antibody (NBP2-85579) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB3GAP2 Products

Bioinformatics Tool for RAB3GAP2 Antibody (NBP2-85579)

Discover related pathways, diseases and genes to RAB3GAP2 Antibody (NBP2-85579). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB3GAP2 Antibody (NBP2-85579)

Discover more about diseases related to RAB3GAP2 Antibody (NBP2-85579).
 

Pathways for RAB3GAP2 Antibody (NBP2-85579)

View related products by pathway.

Research Areas for RAB3GAP2 Antibody (NBP2-85579)

Find related products by research area.

Blogs on RAB3GAP2

There are no specific blogs for RAB3GAP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB3GAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB3GAP2