RAB31 Antibody


Western Blot: RAB31 Antibody [NBP1-79921] - Human Fetal Brain Lysate, concentration 1 ug/ml.
Western Blot: RAB31 Antibody [NBP1-79921] - Lanes: Lane 1 : GFP-Rab5 transfected cos cells Lane 2: GFP-Rab31 transfected cos cells Primary Antibody Dilution: 1 : 500 Secondary Antibody: Goat anti rabbit-HRP Secondary ...read more

Product Details

Reactivity Hu, MkSpecies Glossary
Applications WB

Order Details

RAB31 Antibody Summary

The immunogen for this antibody is RAB31. Peptide sequence EVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RAB31 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB31 Antibody

  • Rab22B
  • RAB31, member RAS oncogene family
  • Ras-related protein Rab-22B
  • ras-related protein Rab-31


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Ca
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, ICC/IF, IP, Flow-IC

Publications for RAB31 Antibody (NBP1-79921) (0)

There are no publications for RAB31 Antibody (NBP1-79921).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB31 Antibody (NBP1-79921) (0)

There are no reviews for RAB31 Antibody (NBP1-79921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB31 Antibody (NBP1-79921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RAB31 Antibody (NBP1-79921)

Discover related pathways, diseases and genes to RAB31 Antibody (NBP1-79921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB31 Antibody (NBP1-79921)

Discover more about diseases related to RAB31 Antibody (NBP1-79921).

Pathways for RAB31 Antibody (NBP1-79921)

View related products by pathway.

Research Areas for RAB31 Antibody (NBP1-79921)

Find related products by research area.

Blogs on RAB31

There are no specific blogs for RAB31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAB31 Antibody and receive a gift card or discount.


Gene Symbol RAB31