RAB31 Antibody - BSA Free

Western Blot: RAB31 Antibody [NBP1-79921] - Host: Rabbit. Target: RAB31. Positive control (+): Human Brain (BR). Negative control (-): Human Liver (LI). Antibody concentration: 1ug/ml

Western Blot: RAB31 Antibody [NBP1-79921] - Human Fetal Brain Lysate, concentration 1 ug/ml.

Western Blot: RAB31 Antibody [NBP1-79921] - Lanes: Lane 1 : GFP-Rab5 transfected cos cells Lane 2: GFP-Rab31 transfected cos cells Primary Antibody Dilution: 1 : 500 Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1 : 5000 Gene name: RAB31 Submitted by: Ruth Herbst, Medical University Vienna.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RAB31 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is RAB31. Peptide sequence EVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB31
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RAB31 Antibody - BSA Free

• Rab22B
• RAB31, member RAS oncogene family
• Ras-related protein Rab-22B
• ras-related protein Rab-31

Background

Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 (PubMed 11784320)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB31
• Uniprot:
  • NP_006859(Human)