RAB23 Antibody

Images

 
Western Blot: RAB23 Antibody [NBP1-79647] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB23 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human Rab23The immunogen for this antibody is Rab23. Peptide sequence DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Rab23 and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB23 Antibody

  • DKFZp781H0695
  • HSPC137
  • MGC8900
  • RAB family small GTP binding protein RAB 23
  • RAB23, member RAS oncogene family
  • ras-related protein Rab-23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
H00004218-M02
Species: Hu
Applications: WB, ELISA
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
NBP1-85966
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-16657
Species: Hu
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF

Publications for RAB23 Antibody (NBP1-79647) (0)

There are no publications for RAB23 Antibody (NBP1-79647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB23 Antibody (NBP1-79647) (0)

There are no reviews for RAB23 Antibody (NBP1-79647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB23 Antibody (NBP1-79647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB23 Products

Bioinformatics Tool for RAB23 Antibody (NBP1-79647)

Discover related pathways, diseases and genes to RAB23 Antibody (NBP1-79647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB23 Antibody (NBP1-79647)

Discover more about diseases related to RAB23 Antibody (NBP1-79647).
 

Pathways for RAB23 Antibody (NBP1-79647)

View related products by pathway.

PTMs for RAB23 Antibody (NBP1-79647)

Learn more about PTMs related to RAB23 Antibody (NBP1-79647).

Blogs on RAB23

There are no specific blogs for RAB23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB23
Uniprot