RAB23 Antibody - BSA Free

Western Blot: RAB23 Antibody [NBP1-58855] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RAB23 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RAB23(RAB23, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB23. Peptide sequence TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB23
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RAB23 Antibody - BSA Free

• DKFZp781H0695
• HSPC137
• MGC8900
• RAB family small GTP binding protein RAB 23
• RAB23, member RAS oncogene family
• ras-related protein Rab-23

Background

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript va

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for RAB23 Antibody (NBP1-58855). (Showing 1 - 1 of 1 FAQ).

1. I am planning to use one of the anti-Rab23 antibodies you offer (NBP1-58855) on tissue from non-mammalian samples. I wanted to ask if it is possible for me to get more data about the antibody (e.g. western blots, immunohistochemistry pictures)?
   • In regards to your inquiry about the anti-RAB23 antibody, there are currently no IHC images that we are able to provide. This is because the antibody has not been tested yet for that application. The western blot data that we are able to provide is on the datasheet. This antibody has not yet been tested on non-mammalian species. If you have a species of interest and the protein sequence we can run an alignment for you to see the similarity. The exact sequence the antibody was raised against is listed on the datasheet, and if you run an alignment or blast, you can check how likely it is to cross react. We typically don't recommend testing anything unless it is 80% or higher.

Bioinformatics

• Gene Symbol: RAB23
• Uniprot:
  • Q9ULC3(Human)