Rab17 Antibody - BSA Free

Staining of human gallbladder shows moderate membranous and cytoplasmic positivity in glandular cells.

Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Analysis in human cell line SK-MEL-30.

Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Staining of human cerebral cortex shows no positivity in neurons as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Rab17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Rab17 Antibody - BSA Free (NBP1-85910) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCCAH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB17
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Rab17 Protein (NBP1-85910PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Rab17 Antibody - BSA Free

• FLJ12538
• RAB17, member RAS oncogene family
• ras-related protein Rab-17

Background

The Rab subfamily of small GTPases plays an important role in the regulation of membrane trafficking. RAB17 is anepithelial cell-specific GTPase (Lutcke et al., 1993 (PubMed 8486736)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB17