QPRT Antibody

Images

 
Western Blot: QPRT Antibody [NBP2-30544] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunohistochemistry: QPRT Antibody [NBP2-30544] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QPRT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKTTPGFRLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QPRT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
QPRT Protein (NBP2-30544PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QPRT Antibody

  • EC 2.4.2.19
  • nicotinate-nucleotide pyrophosphorylase (carboxylating)
  • QAPRTase
  • QPRTasenicotinate-nucleotide pyrophosphorylase [carboxylating]
  • Quinolinate phosphoribosyltransferase [decarboxylating]
  • quinolinate phosphoribosyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45995
Species: Hu
Applications: WB, IHC
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-30544
Species: Hu
Applications: WB, IHC, IHC-P

Publications for QPRT Antibody (NBP2-30544) (0)

There are no publications for QPRT Antibody (NBP2-30544).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QPRT Antibody (NBP2-30544) (0)

There are no reviews for QPRT Antibody (NBP2-30544). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for QPRT Antibody (NBP2-30544) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QPRT Products

Bioinformatics Tool for QPRT Antibody (NBP2-30544)

Discover related pathways, diseases and genes to QPRT Antibody (NBP2-30544). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QPRT Antibody (NBP2-30544)

Discover more about diseases related to QPRT Antibody (NBP2-30544).
 

Pathways for QPRT Antibody (NBP2-30544)

View related products by pathway.

PTMs for QPRT Antibody (NBP2-30544)

Learn more about PTMs related to QPRT Antibody (NBP2-30544).

Blogs on QPRT

There are no specific blogs for QPRT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QPRT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QPRT
Uniprot