Pyruvate Carboxylase Antibody

Images

 
Orthogonal Strategies: Western Blot: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human cell lines HeLa and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cell line A549 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human lymph node shows no positivity in germinal center cells as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human liver and lymph node tissues. Corresponding PC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in proximal tubules.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Pyruvate Carboxylase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ
Specificity
Specificity of human Pyruvate Carboxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pyruvate Carboxylase Protein (NBP2-33407PEP)
Publications
Read Publication using
NBP2-33407 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26302408).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pyruvate Carboxylase Antibody

  • EC 6.4.1
  • EC 6.4.1.1
  • PCBPyruvic carboxylase
  • pyruvate carboxylase
  • pyruvate carboxylase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80533
Species: Hu, Mu
Applications: WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-53053
Species: Hu
Applications: WB
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC

Publications for Pyruvate Carboxylase Antibody (NBP2-33407)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Pyruvate Carboxylase Antibody (NBP2-33407) (0)

There are no reviews for Pyruvate Carboxylase Antibody (NBP2-33407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pyruvate Carboxylase Antibody (NBP2-33407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pyruvate Carboxylase Products

Bioinformatics Tool for Pyruvate Carboxylase Antibody (NBP2-33407)

Discover related pathways, diseases and genes to Pyruvate Carboxylase Antibody (NBP2-33407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyruvate Carboxylase Antibody (NBP2-33407)

Discover more about diseases related to Pyruvate Carboxylase Antibody (NBP2-33407).
 

Pathways for Pyruvate Carboxylase Antibody (NBP2-33407)

View related products by pathway.

PTMs for Pyruvate Carboxylase Antibody (NBP2-33407)

Learn more about PTMs related to Pyruvate Carboxylase Antibody (NBP2-33407).
 

Research Areas for Pyruvate Carboxylase Antibody (NBP2-33407)

Find related products by research area.

Blogs on Pyruvate Carboxylase

There are no specific blogs for Pyruvate Carboxylase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pyruvate Carboxylase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PC
Uniprot