Home » Pyruvate Carboxylase » Pyruvate Carboxylase Research Products » Pyruvate Carboxylase Antibody

Pyruvate Carboxylase Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human cell lines HeLa and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Orthogonal Strategies: Western Blot: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human cell lines HeLa and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cell line A549 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human lymph node shows no positivity in germinal center cells as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human liver and lymph node tissues. Corresponding PC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in proximal tubules.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Pyruvate Carboxylase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ
Specificity
Specificity of human Pyruvate Carboxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pyruvate Carboxylase Protein (NBP2-33407PEP)
Publications
Read Publication using
NBP2-33407 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26302408).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pyruvate Carboxylase Antibody

  • EC 6.4.1
  • EC 6.4.1.1
  • PCBPyruvic carboxylase
  • pyruvate carboxylase
  • pyruvate carboxylase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCK2 Antibody
(JB52-39)
NBP2-75610
Western Blot: PCK2 Antibody (JB52-39) [NBP2-75610] - Analysis of PCK2 on human kidney tissue (1) and MCF-7 cell (2) lysate using anti-PCK2 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: PCK2 Antibody (JB52-39) [NBP2-75610] - Staining PCK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PCK2 Antibody (JB52-39) [NBP2-75610] - Analysis of paraffin-embedded rat kidney tissue using anti-PCK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
G6PC Antibody
NBP1-80533
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB
ME1 Antibody
NBP1-32398
Western Blot: ME1 Antibody [NBP1-32398] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ME1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ME1 Antibody [NBP1-32398] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: ME1 Antibody [NBP1-32398] - Paraffin-embedded human ovarian carcinoma. ME1 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
ME3 Antibody
NBP1-85871
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Species: Hu
Applications: WB, IHC, IHC-P
ME2 Antibody
NBP1-89559
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ME2 antibody NBP1-89559 (A) shows similar protein distribution across tissues to independent antibody NBP1-82434 (B).
Western Blot: ME2 Antibody [NBP1-89559] - Analysis using Anti-ME2 antibody NBP1-89559 (A) shows similar pattern to independent antibody NBP1-82434 (B).
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
PCK1 Antibody
NBP1-54825
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: PCK1 Antibody [NBP1-54825] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Brain Lysate, concentration 1.0ug/ml.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Human Complement
Component C2 ELISA Ki ...
NBP2-60548
ELISA: Human Complement Component C2 ELISA Kit (Colorimetric) [NBP2-60548] - Standard curve.
Species: Hu
HLA DRB4 Antibody
(4C8)
H00003126-M01
Western Blot: HLA DRB4 Antibody (4C8) [H00003126-M01] - HLA-DRB4 monoclonal antibody (M01), clone 4C8. Analysis of HLA-DRB4 expression in human kidney.
Immunohistochemistry-Paraffin: HLA DRB4 Antibody (4C8) [H00003126-M01] - Analysis of monoclonal antibody to HLA-DRB4 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml.
Sandwich ELISA: HLA DRB4 Antibody (4C8) [H00003126-M01] - Detection limit for recombinant GST tagged HLA-DRB4 is approximately 1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 ug of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using NB100-56503 at 25 ug/ml for 3 hours at room temperature. Cells were stained using the NorthernLights(TM) 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(52 Publications)
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
HLA DRB1 Antibody
(SPM288)
NBP2-45312
Western Blot: HLA DRB1 Antibody (SPM288) [NBP2-45312] - Western Blot Analysis of Ramos cells and human spleen tissue lysate using HLA DRB1 Antibody (SPM288).
Immunohistochemistry-Paraffin: HLA DRB1 Antibody (SPM288) [NBP2-45312] - Formalin-fixed, paraffin-embedded human Tonsil stained with HLA DRB1 Antibody (SPM288).
Flow Cytometry: HLA DRB1 Antibody (SPM288) [NBP2-45312] - Flow Cytometric Analysis of human Raji cells using HLA DRB1 Antibody (SPM288).followed by Goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Folic acid treatment restores endothelial specific DHFR expression and activity in Ang II-infused apoE null mice.DHFR expression (A, n?=?8-11) and activity (B, n?=?5-7) measured from endothelial cells (ECs) and EC-denuded aortas isolated from apoE null mice after 4 weeks of infusion. Data show that DHFR expression and activity was restored in FA treated animals specifically in the endothelial cells. eNOS was stained to show that isolation/removal of ECs from the vessels was successful. *p<0.05. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0088899) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10 Analysis of DHFR expression in HeLa.
(13 Publications)
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Glucagon was detected in immersion fixed beta TC-6 mouse beta cell insulinoma cell line using 10 µg/mL Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
beta TC‑6 mouse beta cell insulinoma cell line was stained with Mouse Anti-Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
(3 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
ECHDC1 Antibody
NBP1-53053
Western Blot: ECHDC1 Antibody [NBP1-53053] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
Glutamine
Synthetase Antibody
NB110-41404
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC

Publications for Pyruvate Carboxylase Antibody (NBP2-33407)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Pyruvate Carboxylase Antibody (NBP2-33407) (0)

There are no reviews for Pyruvate Carboxylase Antibody (NBP2-33407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pyruvate Carboxylase Antibody (NBP2-33407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Pyruvate Carboxylase Products

Bioinformatics Tool for Pyruvate Carboxylase Antibody (NBP2-33407)

Discover related pathways, diseases and genes to Pyruvate Carboxylase Antibody (NBP2-33407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyruvate Carboxylase Antibody (NBP2-33407)

Discover more about diseases related to Pyruvate Carboxylase Antibody (NBP2-33407).
 

Pathways for Pyruvate Carboxylase Antibody (NBP2-33407)

View related products by pathway.

PTMs for Pyruvate Carboxylase Antibody (NBP2-33407)

Learn more about PTMs related to Pyruvate Carboxylase Antibody (NBP2-33407).
 

Research Areas for Pyruvate Carboxylase Antibody (NBP2-33407)

Find related products by research area.

Blogs on Pyruvate Carboxylase

There are no specific blogs for Pyruvate Carboxylase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pyruvate Carboxylase Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PC
Uniprot