PTPRD Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PTPRD Antibody [NBP2-49153] - Staining of human cell line RH-30 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of mouse brain shows moderate cytoplasmic positivity in mitral cell layer in olfactory bulb.

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells in medulla.

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTPRD Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PTPRD Recombinant Protein Antigen (NBP2-49153PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTPRD Antibody - BSA Free

• HPTPDELTA
• HPTPMGC119752
• MGC119750
• MGC119751
• protein tyrosine phosphatase, receptor type, D
• Protein-tyrosine phosphatase delta
• PTP delta
• PTPD
• PTPdelta
• PTP-delta
• PTPDMGC119753
• PTPRD
• receptor type, delta polypeptide
• receptor-type tyrosine-protein phosphatase delta
• R-PTP-Delta
• RPTP-Delta

Background

The protein encoded by the PTPRD gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, thus represents a receptor-type PTP. The extracellular region of this protein is composed of three Ig-like and eight fibronectin type III-like domains. Studies of the similar genes in chick and fly suggest the role of this PTP is in promoting neurite growth, and regulating neurons axon guidance. Multiple tissue specific alternatively spliced transcript variants of this gene have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRD