PTPN3 Antibody - BSA Free

Immunohistochemistry-Paraffin: PTPN3 Antibody [NBP1-80868] - Staining of human skin shows moderate membranous positivity in epidermal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTPN3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLAPQDSDSEVSQNRSPHQESLSENNPAQSYLTQ
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PTPN3 Protein (NBP1-80868PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTPN3 Antibody - BSA Free

• DKFZp686N0569
• EC 3.1.3.48
• protein tyrosin phosphatase H1
• protein tyrosine phosphatase, non-receptor type 3
• Protein-tyrosine phosphatase H1
• PTPH1
• PTP-H1
• PTPH1cytoskeletal-associated protein tyrosine phosphatase
• PTPN3
• tyrosine phosphatase
• tyrosine-protein phosphatase non-receptor type 3

Background

The protein encoded by the PTPN3 gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. P97, a cell cycle regulator involved in a variety of membrane related functions, has been shown to be a substrate of this PTP. This PTP was also found to interact with, and be regulated by adaptor protein 14-3-3 beta. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTPN3 Antibody (NBP1-80868)(1)

Publication using NBP1-80868

• Janani G, Zhang L, Badylak S et al. Silk fibroin bioscaffold from Bombyx mori and Antheraea assamensis elicits a distinct host response and macrophage activation paradigm in vivo and in vitro Biomaterials Advances 2022-11-01 [PMID: 36502549] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: PTPN3
• Entrez:
  • 5774(Human)
• Uniprot:
  • P26045(Human)