PTPMT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PTPMT1 Antibody [NBP2-13827] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: PTPMT1 Antibody [NBP2-13827] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPMT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWS PEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTPMT1 Protein (NBP2-13827PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTPMT1 Antibody

  • DUSP23
  • EC 3.1.3.16
  • EC 3.1.3.48
  • FLJ46081
  • MOSPNB4 apoptosis/differentiation related protein
  • Phosphoinositide lipid phosphatase
  • PLIPprotein-tyrosine phosphatase mitochondrial 1
  • protein tyrosine phosphatase, mitochondrial 1
  • PTEN-like phosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB4280
Species: Hu
Applications: Flow, CyTOF-ready
AF4937
Species: Hu
Applications: WB, IHC
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB1654
Species: Hu, Mu, Rt
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13827
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTPMT1 Antibody (NBP2-13827) (0)

There are no publications for PTPMT1 Antibody (NBP2-13827).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPMT1 Antibody (NBP2-13827) (0)

There are no reviews for PTPMT1 Antibody (NBP2-13827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTPMT1 Antibody (NBP2-13827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPMT1 Products

Bioinformatics Tool for PTPMT1 Antibody (NBP2-13827)

Discover related pathways, diseases and genes to PTPMT1 Antibody (NBP2-13827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPMT1 Antibody (NBP2-13827)

Discover more about diseases related to PTPMT1 Antibody (NBP2-13827).
 

Pathways for PTPMT1 Antibody (NBP2-13827)

View related products by pathway.

PTMs for PTPMT1 Antibody (NBP2-13827)

Learn more about PTMs related to PTPMT1 Antibody (NBP2-13827).
 

Research Areas for PTPMT1 Antibody (NBP2-13827)

Find related products by research area.

Blogs on PTPMT1

There are no specific blogs for PTPMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPMT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPMT1