Recombinant Human PTP sigma/PTPRS Protein

Images

 

Product Details

Summary
Product Discontinued
View other related PTP sigma/PTPRS Peptides and Proteins

Order Details


    • Catalog Number
      H00005802-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human PTP sigma/PTPRS Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 31-128 of Human PTPRS full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
PTPRS

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTP sigma/PTPRS Protein

  • EC 3.1.3.48
  • protein tyrosine phosphatase PTPsigma
  • protein tyrosine phosphatase, receptor type, S
  • protein tyrosine phosphatase, receptor type, sigma
  • PTP sigma
  • PTPR sigma
  • PTPRS
  • PTPSIGMA
  • receptor-type tyrosine-protein phosphatase S
  • Receptor-type tyrosine-protein phosphatase sigma
  • R-PTP-S
  • R-PTP-sigma

Background

PTPRS( AAH29496, 31 a.a. - 129 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NBP2-49153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB7475
Species: Hu, Rt
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3697
Species: Hu
Applications: WB
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF482
Species: Mu
Applications: WB, IHC
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00005802-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PTP sigma/PTPRS Recombinant Protein (H00005802-P01) (0)

There are no publications for PTP sigma/PTPRS Recombinant Protein (H00005802-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP sigma/PTPRS Recombinant Protein (H00005802-P01) (0)

There are no reviews for PTP sigma/PTPRS Recombinant Protein (H00005802-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTP sigma/PTPRS Recombinant Protein (H00005802-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTP sigma/PTPRS Products

Bioinformatics Tool for PTP sigma/PTPRS Recombinant Protein (H00005802-P01)

Discover related pathways, diseases and genes to PTP sigma/PTPRS Recombinant Protein (H00005802-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP sigma/PTPRS Recombinant Protein (H00005802-P01)

Discover more about diseases related to PTP sigma/PTPRS Recombinant Protein (H00005802-P01).
 

Pathways for PTP sigma/PTPRS Recombinant Protein (H00005802-P01)

View related products by pathway.

PTMs for PTP sigma/PTPRS Recombinant Protein (H00005802-P01)

Learn more about PTMs related to PTP sigma/PTPRS Recombinant Protein (H00005802-P01).

Blogs on PTP sigma/PTPRS

There are no specific blogs for PTP sigma/PTPRS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTP sigma/PTPRS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRS
Entrez