PTP epsilon Antibody [Alexa Fluor® 405] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human PTP epsilon (NP_006495.1).
Sequence: LRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTPRE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for PTP epsilon Antibody [Alexa Fluor® 405]
Background
PTP epsilon, an R4 receptor protein tyrosine phosphatase, is composed of a short extracellular and two cyplasmic protein phosphatase domains and has been shown to affect neuronal differentiation, endothelial cell growth, vascular development, and possibly mammary tumor development. It has been shown that the cytosolic form of PTP epsilon can be induced by IL-1 and TNF alpha in humans and is a negative regulator of IL-6- and LIF-induced Jak-STAT kinase signaling in rats. Four alternatively spliced protein isoforms have been documented for PTP epsilon: a membrane form, a cytosolic form, the p65 form, which results from translation using an internal initiation codon, and the p67 form, which results from a specific proteolytic cleavage of wild-type PTP epsilon. PTP epsilon expression has been documented in human vascular endothelial cells, astrocytoma cells, and in IW32 erythroleukemia overexpressing p53. PTP epsilon expression has been documented in animal brain, breast, ganglion, heart, kidney, liver, lung, nerve, spinal cord, spleen, testis, and vessel. The membrane and cytosolic forms of PTP epsilon show different tissue expression patterns. ESTs have been isolated from numerous human tissue libraries, including normal human blood, brain, testis, and thyroid, and cancerous human blood, brain, breast, colon, embryo, head/neck, pancreas, and skin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for PTP epsilon Antibody (NBP3-38398AF405) (0)
There are no publications for PTP epsilon Antibody (NBP3-38398AF405).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTP epsilon Antibody (NBP3-38398AF405) (0)
There are no reviews for PTP epsilon Antibody (NBP3-38398AF405).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTP epsilon Antibody (NBP3-38398AF405) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTP epsilon Products
Research Areas for PTP epsilon Antibody (NBP3-38398AF405)
Find related products by research area.
|
Blogs on PTP epsilon