PTH Antibody (5X6R6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTH (P01270). MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGE |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
PTH |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Immunocytochemistry/ Immunofluorescence 1:200 - 1:2000
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
13 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PTH Antibody (5X6R6)
Background
Parathyroid hormone (PTH), which is also designated parathyrin, is an 84 amino acid single chain peptide that functions to regulate calcium metabolism by raising blood levels of calcium through various mechanisms. PTH stimulates bone formation to increase bone mass and strength in rats and humans. Within the PTH molecule, the essential activity is associated with the first 34 amino acids at the amino-terminus of the molecule. The gene encoding PTH maps to human chromosome 11p15.3-p15.1. Parathyroid hormone-related protein (PTH-rP) is an autocrine factor that is structurally related to PTH yet, unlike PTH, which is synthesized only by the parathyroid cells, PTH-rP is synthesized by several cell types. PTH-rP regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Isolated from the culture medium of a human lung cancer cell line, PTH-rP produces PTH-like effects that are characterized as humoral hypercalcemia of malignancy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for PTH Antibody (NBP3-16862) (0)
There are no publications for PTH Antibody (NBP3-16862).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTH Antibody (NBP3-16862) (0)
There are no reviews for PTH Antibody (NBP3-16862).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTH Antibody (NBP3-16862) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTH Products
Research Areas for PTH Antibody (NBP3-16862)
Find related products by research area.
|
Blogs on PTH