PTEN Antibody (2G9)

Images

 
Proximity Ligation Assay: PTEN Antibody (2G9) [H00005728-M01] - Analysis of protein-protein interactions between PDGFRB and PTEN. HeLa cells were stained with anti-PDGFRB rabbit purified polyclonal 1:1200 and anti-PTEN ...read more
Proximity Ligation Assay: PTEN Antibody (2G9) [H00005728-M01] - Analysis of protein-protein interactions between PXN and PTEN. Mahlavu cells were stained with anti-PXN rabbit purified polyclonal 1:1200 and anti-PTEN ...read more
Sandwich ELISA: PTEN Antibody (2G9) [H00005728-M01] - Detection limit for recombinant GST tagged PTEN is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, S-ELISA
Clone
2G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTEN Antibody (2G9) Summary

Immunogen
PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL
Specificity
PTEN (2G9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTEN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00005728-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTEN Antibody (2G9)

  • BZS
  • EC 3.1.3.16,10q23del
  • EC 3.1.3.48
  • EC 3.1.3.67
  • GLM2
  • MMAC1 phosphatase and tensin homolog deleted on chromosome 10
  • MMAC1
  • MMAC1MGC11227
  • Mutated in multiple advanced cancers 1
  • phosphatase and tensin homologDEC
  • phosphatidylinositol-34,5-trisphosphate 3-phosphatase and dual-specificityprotein phosphatase PTEN
  • PTEN
  • PTEN1
  • TEP1MHAM

Background

This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-88937
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
H00005728-M01
Species: Hu
Applications: WB, ELISA, PLA, S-ELISA

Publications for PTEN Antibody (H00005728-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00005728-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for PTEN Antibody (H00005728-M01) (0)

There are no reviews for PTEN Antibody (H00005728-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTEN Antibody (H00005728-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTEN Products

Bioinformatics Tool for PTEN Antibody (H00005728-M01)

Discover related pathways, diseases and genes to PTEN Antibody (H00005728-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTEN Antibody (H00005728-M01)

Discover more about diseases related to PTEN Antibody (H00005728-M01).
 

Pathways for PTEN Antibody (H00005728-M01)

View related products by pathway.

PTMs for PTEN Antibody (H00005728-M01)

Learn more about PTMs related to PTEN Antibody (H00005728-M01).
 

Research Areas for PTEN Antibody (H00005728-M01)

Find related products by research area.

Blogs on PTEN.

Autophagy Research Update: What a difference a year makes!
By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque...  Read full blog post.

Neurovascular signaling for repair enhances brain metastasis
By Jamshed Arslan, Pharm. D., PhD. Stroke    is a leading cause of mortality and morbidity worldwide. Cellular players – neurons, astrocytes, endothelial and stromal cells – involved in post-stroke repair t...  Read full blog post.

Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein
By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

Carbonic anhydrase IX (CAIX) - a reliable histochemical marker of hypoxia
Carbonic anhydrase IX is a member of the carbonic anhydrase family. This family consists of catalytic enzymes capable of converting carbon dioxide and water into carbonic acid, protons, and bicarbonate ions. This family of molecules is abundantly e...  Read full blog post.

CAIX - One of the Best Cellular Markers of Hypoxia
The protein, carbonic anhydrase IX, belongs to the carbonic anhydrase family which consists of enzymes that rapidly convert carbon dioxide and water into the end products of carbonic acid, protons, and bicarbonate ions. These enzymes play a widespread...  Read full blog post.

Getting SHIP-shape Over Tumour Suppression
PTEN antibodies have shown PTEN to be an important tumor suppressor and, in mutated form, a factor in cancer development. However, a recent study, led by Robert Rickert, shows that the SHIP gene may also be an important tumor suppressor in B-cell lymp...  Read full blog post.

PTEN Antibodies and Cancer Research
Phosphatase and tensin homologue (PTEN) antibodies are important tools for cancer research. PTEN is an important tumor suppressor but, in mutated form, is also expressed in a high number of cancers. We at Novus Biologicals have a wide PTEN antibody da...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTEN Antibody (2G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTEN
Entrez
OMIM
Uniprot