PRPF31 Antibody

Images

 
Genetic Strategies: Western Blot: PRPF31 Antibody [NBP1-82510] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunohistochemistry-Paraffin: PRPF31 Antibody [NBP1-82510] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans.
Western Blot: PRPF31 Antibody [NBP1-82510] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

PRPF31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGF
Specificity
Specificity of human PRPF31 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRPF31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PRPF31 Protein (NBP1-82510PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRPF31 Antibody

  • DKFZp566J153
  • hPrp31
  • NY-BR-99
  • Pre-mRNA-processing factor 31
  • Protein 61K
  • PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae)
  • PRP31 pre-mRNA processing factor 31 homolog (yeast)
  • PRP31RP11
  • Serologically defined breast cancer antigen NY-BR-99
  • U4/U6 small nuclear ribonucleoprotein Prp31
  • U4/U6 snRNP 61 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22273
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81681
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-57100
Species: Hu
Applications: ICC/IF
H00003757-Q01
Species: Hu
NBP1-84412
Species: Hu
Applications: WB, IHC, IHC-P
NB300-137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90086
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1633
Species: Mu
Applications: WB
NBP1-82510
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRPF31 Antibody (NBP1-82510) (0)

There are no publications for PRPF31 Antibody (NBP1-82510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPF31 Antibody (NBP1-82510) (0)

There are no reviews for PRPF31 Antibody (NBP1-82510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRPF31 Antibody (NBP1-82510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PRPF31 Antibody (NBP1-82510)

Discover related pathways, diseases and genes to PRPF31 Antibody (NBP1-82510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPF31 Antibody (NBP1-82510)

Discover more about diseases related to PRPF31 Antibody (NBP1-82510).
 

Pathways for PRPF31 Antibody (NBP1-82510)

View related products by pathway.

PTMs for PRPF31 Antibody (NBP1-82510)

Learn more about PTMs related to PRPF31 Antibody (NBP1-82510).

Blogs on PRPF31

There are no specific blogs for PRPF31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRPF31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPF31
Entrez
Uniprot