PRP19 Antibody (4M3Z1)

Western Blot: PRP19 Antibody (4M3Z1) [NBP3-16853] - Western blot analysis of extracts of various cell lines, using PRP19 Rabbit mAb (NBP3-16853) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: PRP19 Antibody (4M3Z1) [NBP3-16853] - Western blot analysis of extracts of Rat spleen, using PRP19 Rabbit mAb (NBP3-16853) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: PRP19 Antibody (4M3Z1) [NBP3-16853] - Immunofluorescence analysis of U-2 OS cells using PRP19 Rabbit mAb (NBP3-16853) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: PRP19 Antibody (4M3Z1) [NBP3-16853] - Immunohistochemistry analysis of PRP19 in paraffin-embedded human colon carcinoma tissue using PRP19 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PRP19 Antibody (4M3Z1) [NBP3-16853] - Immunohistochemistry analysis of PRP19 in paraffin-embedded mouse testis tissue using PRP19 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PRP19 Antibody (4M3Z1) [NBP3-16853] - Immunohistochemistry analysis of PRP19 in paraffin-embedded mouse intestin tissue using PRP19 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PRP19 Antibody (4M3Z1) [NBP3-16853] - Immunohistochemistry analysis of PRP19 in paraffin-embedded rat colon tissue using PRP19 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PRP19 Antibody (4M3Z1) [NBP3-16853] - Immunohistochemistry analysis of PRP19 in paraffin-embedded mouse brain tissue using PRP19 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4M3Z1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PRP19 Antibody (4M3Z1) Summary

• Description: Novus Biologicals Rabbit PRP19 Antibody (4M3Z1) (NBP3-16853) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-504 of human PRPF19(Q9UMS4). FSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PRPF19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRP19 Antibody (4M3Z1)

• hPso4
• NMP200SNEV
• Nuclear matrix protein 200
• nuclear matrix protein NMP200 related to splicing factor PRP19
• pre-mRNA-processing factor 19
• PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
• PRP19PRP19/PSO4 homolog (S. cerevisiae)
• PSO4PRP19/PSO4 homolog
• Senescence evasion factor
• UBOX4

Background

In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRPF19