RBM22 Antibody

Images

 
Western Blot: RBM22 Antibody [NBP1-85379] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: RBM22 Antibody [NBP1-85379] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Western Blot: RBM22 Antibody [NBP1-85379] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM22 Protein (NBP1-85379PEP)
Publications
Read Publications using NBP1-85379.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM22 Antibody

  • Cwc2
  • FLJ10290
  • fSAP47
  • functional spliceosome-associated protein 47
  • pre-mRNA-splicing factor RBM22
  • RNA binding motif protein 22
  • ZC3H16RNA-binding motif protein 22
  • Zinc finger CCCH domain-containing protein 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06556
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58541
Species: Hu
Applications: ICC/IF
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-46033
Species: Hu
Applications: WB, IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88591
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81863
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBM22 Antibody (NBP1-85379)(2)

Reviews for RBM22 Antibody (NBP1-85379) (0)

There are no reviews for RBM22 Antibody (NBP1-85379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM22 Antibody (NBP1-85379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM22 Products

Bioinformatics Tool for RBM22 Antibody (NBP1-85379)

Discover related pathways, diseases and genes to RBM22 Antibody (NBP1-85379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM22 Antibody (NBP1-85379)

Discover more about diseases related to RBM22 Antibody (NBP1-85379).
 

Pathways for RBM22 Antibody (NBP1-85379)

View related products by pathway.

Blogs on RBM22

There are no specific blogs for RBM22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM22