SNM1 Antibody

Images

 
Immunocytochemistry: SNM1 Antibody [NBP1-89663] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: SNM1 Antibody [NBP1-89663] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P, ICC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCLRE1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNM1 Protein (NBP1-89663PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNM1 Antibody

  • DNA cross-link repair 1A
  • hSNM1
  • hSNM1A
  • KIAA0086SNM1 homolog A
  • PSO2 homolog
  • SNM1S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03563
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-183
Species: Hu
Applications: WB
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-39036
Species: Hu
Applications: IHC, IHC-P
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051692-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi

Publications for SNM1 Antibody (NBP1-89663) (0)

There are no publications for SNM1 Antibody (NBP1-89663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNM1 Antibody (NBP1-89663) (0)

There are no reviews for SNM1 Antibody (NBP1-89663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SNM1 Antibody (NBP1-89663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNM1 Products

SNM1 NBP1-89663

Bioinformatics Tool for SNM1 Antibody (NBP1-89663)

Discover related pathways, diseases and genes to SNM1 Antibody (NBP1-89663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNM1 Antibody (NBP1-89663)

Discover more about diseases related to SNM1 Antibody (NBP1-89663).
 

Pathways for SNM1 Antibody (NBP1-89663)

View related products by pathway.

Research Areas for SNM1 Antibody (NBP1-89663)

Find related products by research area.

Blogs on SNM1

There are no specific blogs for SNM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCLRE1A