Protocadherin gamma C3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Protocadherin gamma C3 Antibody [NBP2-57770] - Staining of human cell line U-251 MG shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protocadherin gamma C3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES
• Predicted Species: Mouse (98%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCDHGC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Protocadherin gamma C3 Recombinant Protein Antigen (NBP2-57770PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Protocadherin gamma C3 Antibody - BSA Free

• Cadherin-Like 2
• PC43
• PC-43
• PCDH2
• PCDH-GAMMA-C3
• PCDHGC3
• protocadherin 2
• Protocadherin 43
• Protocadherin gamma C3
• protocadherin gamma subfamily C, 3
• protocadherin gamma-C3
• Protocadherin-2
• protocadherin-43

Background

The PCDHGC3 gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked onchromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism maybe involved in their regulat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCDHGC3