Protocadherin gamma C3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Protocadherin gamma C3 Antibody [NBP2-57770] - Staining of human cell line U-251 MG shows localization to plasma membrane.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protocadherin gamma C3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES
Specificity
Specificity of human Protocadherin gamma C3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDHGC3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Protocadherin gamma C3 Recombinant Protein Antigen (NBP2-57770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Protocadherin gamma C3 Antibody

  • Cadherin-Like 2
  • PC43
  • PC-43
  • PCDH2
  • PCDH-GAMMA-C3
  • PCDHGC3
  • protocadherin 2
  • Protocadherin 43
  • Protocadherin gamma C3
  • protocadherin gamma subfamily C, 3
  • protocadherin gamma-C3
  • Protocadherin-2
  • protocadherin-43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86216
Species: Hu
Applications: IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP2-60616
Species: Hu
AF1444
Species: Mu
Applications: WB, IHC
NBP1-83054
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15065
Species: Hu
Applications: WB, IHC, IHC-P
NB500-327
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NBP2-13901
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for Protocadherin gamma C3 Antibody (NBP2-57770) (0)

There are no publications for Protocadherin gamma C3 Antibody (NBP2-57770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin gamma C3 Antibody (NBP2-57770) (0)

There are no reviews for Protocadherin gamma C3 Antibody (NBP2-57770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Protocadherin gamma C3 Antibody (NBP2-57770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Protocadherin gamma C3 Products

Bioinformatics Tool for Protocadherin gamma C3 Antibody (NBP2-57770)

Discover related pathways, diseases and genes to Protocadherin gamma C3 Antibody (NBP2-57770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin gamma C3 Antibody (NBP2-57770)

Discover more about diseases related to Protocadherin gamma C3 Antibody (NBP2-57770).
 

Pathways for Protocadherin gamma C3 Antibody (NBP2-57770)

View related products by pathway.

PTMs for Protocadherin gamma C3 Antibody (NBP2-57770)

Learn more about PTMs related to Protocadherin gamma C3 Antibody (NBP2-57770).

Blogs on Protocadherin gamma C3

There are no specific blogs for Protocadherin gamma C3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin gamma C3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHGC3