Proprotein convertase PC4 Antibody - BSA Free

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Proprotein convertase PC4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Proprotein convertase PC4 Antibody - BSA Free (NBP1-88010) is a polyclonal antibody validated for use in IHC. Anti-Proprotein convertase PC4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCSK4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Proprotein convertase PC4 Protein (NBP1-88010PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Proprotein convertase PC4 Antibody - BSA Free

• DKFZp434B217
• EC 3.4.21
• EC 3.4.21.75
• EC 3.4.21.93
• MGC34749
• PC4
• PC4EC 3.4.21.-
• PCSK4
• Proprotein convertase 4
• proprotein convertase subtilisin/kexin type 4
• SPC5

Background

Proprotein convertase PC4 also known as Proprotein convertase subtilisin/kexin type 4, has 2 isoforms, a 775 amino acid long isoform that is 83 kDa and a short 242 amino acid isoform that is 26 kDa, has placenta tissue specificity and membrane subcellular location, plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor, in transcriptional coactivation, and may be involved in stabilizing the multiprotein transcription complex. Current research is being performed on the following diseases and disorders: dna topoisomerase I, pharyngitis, thyroiditis, and lymphoma. This protein has also shown to have interactions with SOCS1 and IGF2 in biological processes such as proteolysis, binding of sperm to zona pellucida, acrosome reaction, fertilization, and sperm capacitation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Proprotein convertase PC4 Antibody (NBP1-88010)(1)

Publication using NBP1-88010

• Shintaro Kawai, Hiroyuki Ariyasu, Shinsuke Uraki, Ken Takeshima, Shuhei Morita, Hidefumi Inaba, Hiroshi Iwakura, Asako Doi, Takuya Ohashi, Mitsumasa Kawago, Naoki Matsuoka, Shintaro Okamura, Satoru Tsujii, Takashi Akamizu Imbalanced Expression of IGF2 and PCSK4 Is Associated With Overproduction of Big IGF2 in SFT With NICTH: A Pilot Study. The Journal of clinical endocrinology and metabolism 2019-01-04 [PMID: 29897468]

Bioinformatics

• Gene Symbol: PCSK4