Proprotein convertase PC4 Antibody

Images

 
Immunohistochemistry-Paraffin: Proprotein convertase PC4 Antibody [NBP1-88010] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry: Proprotein convertase PC4 Antibody [NBP1-88010] - Staining of human cerebral cortex shows strong cytoplasmic positivity in granular pattern in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proprotein convertase PC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCSK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proprotein convertase PC4 Protein (NBP1-88010PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proprotein convertase PC4 Antibody

  • DKFZp434B217
  • EC 3.4.21
  • EC 3.4.21.75
  • EC 3.4.21.93
  • MGC34749
  • PC4EC 3.4.21.-
  • Proprotein convertase 4
  • proprotein convertase subtilisin/kexin type 4
  • SPC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
2984-SE
Species: Hu
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007866-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
AF6380
Species: Mu
Applications: WB
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF

Publications for Proprotein convertase PC4 Antibody (NBP1-88010) (0)

There are no publications for Proprotein convertase PC4 Antibody (NBP1-88010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proprotein convertase PC4 Antibody (NBP1-88010) (0)

There are no reviews for Proprotein convertase PC4 Antibody (NBP1-88010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Proprotein convertase PC4 Antibody (NBP1-88010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proprotein convertase PC4 Products

Bioinformatics Tool for Proprotein convertase PC4 Antibody (NBP1-88010)

Discover related pathways, diseases and genes to Proprotein convertase PC4 Antibody (NBP1-88010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proprotein convertase PC4 Antibody (NBP1-88010)

Discover more about diseases related to Proprotein convertase PC4 Antibody (NBP1-88010).
 

Pathways for Proprotein convertase PC4 Antibody (NBP1-88010)

View related products by pathway.

PTMs for Proprotein convertase PC4 Antibody (NBP1-88010)

Learn more about PTMs related to Proprotein convertase PC4 Antibody (NBP1-88010).

Blogs on Proprotein convertase PC4

There are no specific blogs for Proprotein convertase PC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proprotein convertase PC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK4