Proprotein convertase PC4 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PCSK4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Proprotein convertase PC4 Antibody
Background
Proprotein convertase PC4 also known as Proprotein convertase subtilisin/kexin type 4, has 2 isoforms, a 775 amino acid long isoform that is 83 kDa and a short 242 amino acid isoform that is 26 kDa, has placenta tissue specificity and membrane subcellular location, plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor, in transcriptional coactivation, and may be involved in stabilizing the multiprotein transcription complex. Current research is being performed on the following diseases and disorders: dna topoisomerase I, pharyngitis, thyroiditis, and lymphoma. This protein has also shown to have interactions with SOCS1 and IGF2 in biological processes such as proteolysis, binding of sperm to zona pellucida, acrosome reaction, fertilization, and sperm capacitation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Po, Pm
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Proprotein convertase PC4 Antibody (NBP1-88010) (0)
There are no publications for Proprotein convertase PC4 Antibody (NBP1-88010).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Proprotein convertase PC4 Antibody (NBP1-88010) (0)
There are no reviews for Proprotein convertase PC4 Antibody (NBP1-88010).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Proprotein convertase PC4 Antibody (NBP1-88010) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Proprotein convertase PC4 Products
Bioinformatics Tool for Proprotein convertase PC4 Antibody (NBP1-88010)
Discover related pathways, diseases and genes to Proprotein convertase PC4 Antibody (NBP1-88010). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Proprotein convertase PC4 Antibody (NBP1-88010)
Discover more about diseases related to Proprotein convertase PC4 Antibody (NBP1-88010).
| | Pathways for Proprotein convertase PC4 Antibody (NBP1-88010)
View related products by pathway.
|
PTMs for Proprotein convertase PC4 Antibody (NBP1-88010)
Learn more about PTMs related to Proprotein convertase PC4 Antibody (NBP1-88010).
|
Blogs on Proprotein convertase PC4