Protein S/PROS1 Antibody - BSA Free

Western Blot: Protein S/PROS1 Antibody [NBP1-59165] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Immunohistochemistry-Paraffin: Protein S Antibody [NBP1-59165] - Human Liver tissue 5ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Protein S/PROS1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PROS1(protein S (alpha)) The peptide sequence was selected from the middle region of PROS1 (NP_000304). Peptide sequence MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL. The peptide sequence for this immunogen was taken from within the described region.
• Localization: Secreted.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PROS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 76 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Protein S/PROS1 Antibody - BSA Free

• EC 3.4.21
• PROS
• PROS1
• protein S (alpha)
• Protein S
• protein Sa
• PS21
• PS22
• PS23
• PS24
• PS25
• PSA
• vitamin K-dependent plasma protein S
• vitamin K-dependent protein S

Background

PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protein S/PROS1 Antibody (NBP1-59165)(2)

Publications using NBP1-59165

• Farkas MH, Lew DS, Sousa ME et al. Mutations in Pre-mRNA Processing Factors 3, 8, and 31 Cause Dysfunction of the Retinal Pigment Epithelium. Am. J Pathol. 2014-08-08 [PMID: 25111227]
• Ten Hum. Mutat. 29 (7), 939-947. 2008-01-01 [PMID: 18435454]

Bioinformatics

• Gene Symbol: PROS1
• Entrez:
  • 5627(Human)
  • 19128(Mouse)
  • 81750(Rat)
• Uniprot:
  • P07225()