We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Protein Phosphatase 1 beta Antibody - BSA Free

Images

 
Immunohistochemistry: Protein Phosphatase 1 beta Antibody [NBP3-35355] - Immunohistochemistry analysis of paraffin-embedded Human placenta using Protein Phosphatase 1 beta Rabbit pAb at dilution of 1:20 (40x lens). High ...read more
Western Blot: Protein Phosphatase 1 beta Antibody [NBP3-35355] - Western blot analysis of various lysates using Protein Phosphatase 1 beta Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat ...read more
Immunocytochemistry/ Immunofluorescence: Protein Phosphatase 1 beta Antibody [NBP3-35355] - Immunofluorescence analysis of H9C2 cells using Protein Phosphatase 1 beta Rabbit pAb at dilution of 1:100. Secondary antibody: ...read more
Immunocytochemistry/ Immunofluorescence: Protein Phosphatase 1 beta Antibody [NBP3-35355] - Immunofluorescence analysis of L929 cells using Protein Phosphatase 1 beta Rabbit pAb at dilution of 1:100. Secondary antibody: ...read more
Immunocytochemistry/ Immunofluorescence: Protein Phosphatase 1 beta Antibody [NBP3-35355] - Immunofluorescence analysis of U2OS cells using Protein Phosphatase 1 beta Rabbit pAb at dilution of 1:100. Secondary antibody: ...read more
Immunohistochemistry: Protein Phosphatase 1 beta Antibody [NBP3-35355] - Immunohistochemistry analysis of paraffin-embedded Mouse stomach using Protein Phosphatase 1 beta Rabbit pAb at dilution of 1:20 (40x lens). High ...read more
Immunohistochemistry: Protein Phosphatase 1 beta Antibody [NBP3-35355] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Protein Phosphatase 1 beta Rabbit pAb at dilution of 1:20 (40x lens). High ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Protein Phosphatase 1 beta Antibody - BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 227-327 of human Protein Phosphatase 1 beta (NP_002700.1).

Sequence:
VEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1CB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Protein Phosphatase 1 beta Antibody - BSA Free

  • EC 3.1.3.16
  • EC 3.1.3.53
  • MGC3672
  • PP1beta
  • PP-1Bprotein phosphatase 1, catalytic subunit, delta isoform
  • PPP1CD
  • protein phosphatase 1, catalytic subunit, beta isoform
  • protein phosphatase 1, catalytic subunit, beta isozyme
  • protein phosphatase 1-beta
  • protein phosphatase 1-delta
  • serine/threonine protein phosphatase PP1-beta catalytic subunit
  • serine/threonine-protein phosphatase PP1-beta catalytic subunit

Background

Protein phosphatase 1 (PP1) is a major eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular functions through the interaction of its catalytic subunit (PP1c) with over fifty different established or putative regulatory subunits (1). The coordinated and reciprocal action of serine/threonine (Ser/Thr) protein kinases and phosphatases produces transient phosphorylation, a fundamental regulatory mechanism for many biological processes. PP1 is ubiquitously distributed and regulates a broad range of cellular functions, including glycogen metabolism, cell-cycle progression and muscle relaxation. PP1 has evolved effective catalytic machinery but lacks substrate specificity. Substrate specificity is conferred upon PP1 through interactions with a large number of regulatory subunits (2). It has been shown that PP1 determines the efficacy of learning and memory by limiting acquisition and favoring memory decline. When PP1 is genetically inhibited during learning, short intervals between training episodes are sufficient for optimal performance (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45384
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF6465
Species: Hu, Rt
Applications: ICC, WB
H00050848-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, S-ELISA, WB
NB100-1972
Species: Ba, Ca, Ch, Fi, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-35077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00054940-B01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-2146
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-02272
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for Protein Phosphatase 1 beta Antibody (NBP3-35355) (0)

There are no publications for Protein Phosphatase 1 beta Antibody (NBP3-35355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Phosphatase 1 beta Antibody (NBP3-35355) (0)

There are no reviews for Protein Phosphatase 1 beta Antibody (NBP3-35355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protein Phosphatase 1 beta Antibody (NBP3-35355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein Phosphatase 1 beta Products

Research Areas for Protein Phosphatase 1 beta Antibody (NBP3-35355)

Find related products by research area.

Blogs on Protein Phosphatase 1 beta.

Myc-tag: The "Monkey Wrench" of Proteomic Tools
c-Myc is a well-characterized transcription factor encoded by the c-Myc gene on human chromosome 8q24. This cellular proto-oncogene, also known as p62, is commonly activated in a variety of tumor cells and plays a crucial role in cellular proliferatio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Phosphatase 1 beta Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1CB