Home » OCIAD1 » OCIAD1 Antibodies » OCIAD1 Antibody

OCIAD1 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: OCIAD1 Antibody [H00054940-B01P] - Analysis of OCIAD1 expression in human pancreas.
Western Blot: OCIAD1 Antibody [H00054940-B01P] - Analysis of OCIAD1 expression in human pancreas.
Western Blot: OCIAD1 Antibody [H00054940-B01P] - Analysis of OCIAD1 expression in transfected 293T cell line by OCIAD1 polyclonal antibody. Lane 1: OCIAD1 transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

OCIAD1 Antibody Summary

Immunogen
OCIAD1 (AAH03409, 1 a.a. - 245 a.a.) full-length human protein. MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
Specificity
OCIAD1 - OCIA domain containing 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
OCIAD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA.
Publications
Read Publications using H00054940-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OCIAD1 Antibody

  • Asrij
  • MGC111072
  • OCIA domain containing 1
  • OCIA domain-containing protein 1
  • OCIAFLJ20455
  • Ovarian carcinoma immunoreactive antigen
  • TPA018

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Protein
Phosphatase 1 beta An
NBP1-32618
Western Blot: Protein Phosphatase 1 beta Antibody [NBP1-32618] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PPP1CB antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Frozen: Protein Phosphatase 1 beta Antibody [NBP1-32618] - Frozen-sectioned adult mouse cerebellum. Green: PPP1CB stained by PPP1CB antibody diluted at 1:250. Red: NF-H, stained by NF-H antibody [114] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: Protein Phosphatase 1 beta Antibody [NBP1-32618] - Proetin Phosphatase 1 beta Antibody detects PPP1CB protein at cytoplasm and nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. Proetin Phosphatase 1 beta stained by Proetin Phosphatase 1 beta Antibody diluted at 1:3000. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
SLC35F2 Antibody
NBP2-58197
Western Blot: SLC35F2 Antibody [NBP2-58197] - Analysis in human cell line PC-3.
Western Blot: SLC35F2 Antibody [NBP2-58197] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: SLC35F2 Antibody [NBP2-58197] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, WB
S100A2 Antibody
(CPTC-S100A2-2) - Azi ...
NBP2-79899
Protein Array: S100A2 Antibody (CPTC-S100A2-2) - Azide and BSA Free [NBP2-79899] - Analysis of Protein Array containing more than 19,000 full-length human proteins using S100A2 Antibody (CPTC-S100A2-2). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: S100A2 Antibody (CPTC-S100A2-2) - Azide and BSA Free [NBP2-79899] - Immunofluorescence Analysis of A549 cells labeling S100A2 with S100A2 Antibody (CPTC-S100A2-2) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is RedDot (Red)
Immunohistochemistry-Paraffin: S100A2 Antibody (CPTC-S100A2-2) - Azide and BSA Free [NBP2-79899] - Formalin-fixed, paraffin-embedded human Skin stained with S100A2 Mouse Monoclonal Antibody (CPTC-S100A2-2).
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD320/TCblR/8D6A
Antibody
AF1557
CD320/TCblR/8D6A Antibody
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB
Lipoprotein a
Antibody (4H1) - BSA
NBP2-37477
ELISA: Lipoprotein a Antibody (4H1) [NBP2-37477] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Lipoprotein a Antibody (4H1) [NBP2-37477] - Western blot analysis using LPA mAb against human LPA recombinant protein. (Expected MW is 34.1 kDa)
Immunocytochemistry/Immunofluorescence: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunofluorescence analysis of HepG2 cells using LPA mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
gp96/HSP90B1/GRP94
Antibody (9G10)
NB300-619
Immunocytochemistry/Immunofluorescence: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - GR94 in human primary fibroblasts, ER staining. Primary antibody incubation: 1:250 in 10% Serum in PBST (0.1% Triton) O/N 4C. Secondary: Donkey anti-rat 647 1:500 2h RT. ICC/IF image submitted by a verifed customer review.
Immunocytochemistry/Immunofluorescence: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Analysis of Glucose-Regulated Protein 94 using Glucose-Regulated Protein 94 Monoclonal Antibody (9G10) shows staining in C6 Cells. Glucose-Regulated Protein 94 (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucose-Regulated Protein 94 at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Analysis of Glucose-Regulated Protein 94 using Glucose-Regulated Protein 94 Monoclonal Antibody (9G10) shows staining in Hela Cells. Glucose-Regulated Protein 94 (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucose-Regulated Protein 94 at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Reviews)
(1 Publication)
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
DDB1 Antibody
NBP1-33061
Western Blot: DDB1 Antibody [NBP1-33061] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with DDB1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: DDB1 Antibody [NBP1-33061] - Analysis of paraformaldehyde-fixed HeLa.
Immunohistochemistry-Paraffin: DDB1 Antibody [NBP1-33061] - Cal27 Xenograft , using DDB1 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
PLGF [HRP]
DPG00
(1 Review)
(68 Publications)
Species: Hu
Applications: ELISA
CELSR1 Antibody
NBP2-55658
Immunocytochemistry/Immunofluorescence: CELSR1 Antibody [NBP2-55658] - Staining of human cell line A549 shows localization to plasma membrane.
Species: Hu
Applications: ICC/IF
CD38 Antibody
(1G7F4) - BSA Free
NBP2-25250
Immunohistochemistry-Frozen: CD38 Antibody (1G7F4) [NBP2-25250] - B cell lymphoma tumor sections (Ramos). Antibody Dilution 1:200. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: CD38 Antibody (1G7F4) [NBP2-25250] - HuH-7 cells (human liver cancer cell line) stained with Alexa Fluor 647 conjugated CD38 antibody. Image using the Alexa Fluor 647 format of this antibody. ICC/IF image submitted by a verified customer review.
Western Blot: CD38 Antibody (1G7F4) [NBP2-25250] - Analysis of (A) Human Jurkat, (B) Human Ramos and (C) Mouse EL4 lysate using this antibody at 4 ug/mL.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
OCIAD2 Antibody
NBP1-82682
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82682] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82682] - Staining in human kidney and skeletal muscle tissues using anti-OCIAD2 antibody. Corresponding OCIAD2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: OCIAD2 Antibody [NBP1-82682] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Human peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human Integrin  beta 1/CD29 Monoclonal Antibody (Catalog # MAB17781, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
Integrin  beta 1/CD29 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human Integrin  beta 1/CD29 Monoclonal Antibody (Catalog # MAB17781) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
A549 human lung carcinoma cell line was stained with Mouse Anti-Human Integrin  beta 1/CD29 Monoclonal Antibody (Catalog # MAB17781, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(4 Reviews)
(23 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Integrin alpha
E/CD103 Antibody (Ber ...
NBP1-97564
Flow Cytometry: Integrin alpha E/CD103 Antibody (Ber-ACT8) [NBP1-97564] - Staining of CD103 on human peripheral blood cells with anti-CD103 (Ber-ACT8) APC.
Flow Cytometry: Integrin alpha E/CD103 Antibody (Ber-ACT8) [NBP1-97564] - Staining of CD103 on PHA-activated PBMC with anti-CD103 (Ber-ACT8) FITC.
Flow Cytometry: Integrin alpha E/CD103 Antibody (Ber-ACT8) [NBP1-97564] - Staining of CD103 on PHA-activated PBMC with anti-CD103 (Ber-ACT8) PE.
(1 Publication)
Species: Hu, Pm
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-Fr, IP, WB
Calumenin Antibody
NBP2-92901
Immunocytochemistry/Immunofluorescence: Calumenin Antibody [NBP2-92901] - Analysis of NIH-3T3 cells using Calumenin at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-92901] - Paraffin-embedded mouse lung using Calumenin .
Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-92901] - Paraffin-embedded mouse skin using Calumenin .
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for OCIAD1 Antibody (H00054940-B01P)(2)


Reviews for OCIAD1 Antibody (H00054940-B01P) (0)

There are no reviews for OCIAD1 Antibody (H00054940-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCIAD1 Antibody (H00054940-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OCIAD1 Products

Bioinformatics Tool for OCIAD1 Antibody (H00054940-B01P)

Discover related pathways, diseases and genes to OCIAD1 Antibody (H00054940-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCIAD1 Antibody (H00054940-B01P)

Discover more about diseases related to OCIAD1 Antibody (H00054940-B01P).
 

Pathways for OCIAD1 Antibody (H00054940-B01P)

View related products by pathway.

PTMs for OCIAD1 Antibody (H00054940-B01P)

Learn more about PTMs related to OCIAD1 Antibody (H00054940-B01P).
 

Research Areas for OCIAD1 Antibody (H00054940-B01P)

Find related products by research area.

Blogs on OCIAD1

There are no specific blogs for OCIAD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCIAD1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol OCIAD1
Entrez
Uniprot