Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Images

 
Western Blot: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] - Western Blot analysis of lysates from Mouse testis using Protein Kinase A regulatory subunit I alpha Rabbit pAbat 1:1000 ...read more
Immunocytochemistry/ Immunofluorescence: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] - Immunofluorescence analysis of NIH/3T3 cells using Protein Kinase A regulatory subunit I alpha Rabbit pAb at ...read more
Immunocytochemistry/ Immunofluorescence: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] - Immunofluorescence analysis of NIH/3T3 cells using Protein Kinase A regulatory subunit I alpha Rabbit pAb at ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Protein Kinase A regulatory subunit I alpha Antibody - BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-386 of human Protein Kinase A regulatory subunit I alpha (NP_002725.1).

Sequence:
AAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKAR1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

  • cAMP-dependent protein kinase regulatory subunit RIalpha
  • cAMP-dependent protein kinase type I-alpha regulatory chain
  • cAMP-dependent protein kinase type I-alpha regulatory subunit
  • CAR
  • CNC
  • CNC1
  • MGC17251
  • PKA R1 alpha
  • PKA1
  • PKR1
  • PPNAD1
  • PRKAR1
  • PRKAR1A
  • Protein Kinase A regulatory subunit I alpha
  • protein kinase A type 1a regulatory subunit
  • protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1)
  • Tissue-specific extinguisher 1
  • TSE1
  • TSE1DKFZp779L0468

Background

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
AF7356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF2654
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
AF1106
Species: Hu
Applications: IP, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00001556-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-38258
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for Protein Kinase A regulatory subunit I alpha Antibody (NBP3-35902) (0)

There are no publications for Protein Kinase A regulatory subunit I alpha Antibody (NBP3-35902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Kinase A regulatory subunit I alpha Antibody (NBP3-35902) (0)

There are no reviews for Protein Kinase A regulatory subunit I alpha Antibody (NBP3-35902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protein Kinase A regulatory subunit I alpha Antibody (NBP3-35902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein Kinase A regulatory subunit I alpha Products

Research Areas for Protein Kinase A regulatory subunit I alpha Antibody (NBP3-35902)

Find related products by research area.

Blogs on Protein Kinase A regulatory subunit I alpha

There are no specific blogs for Protein Kinase A regulatory subunit I alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Kinase A regulatory subunit I alpha Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAR1A