Proteasome 20S beta 6 Antibody


Western Blot: Proteasome 20S beta 6 Antibody [NBP1-88024] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA more
Immunohistochemistry-Paraffin: Proteasome 20S beta 6 Antibody [NBP1-88024] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Proteasome 20S beta 6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLT
Specificity of human Proteasome 20S beta 6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proteasome 20S beta 6 Protein (NBP1-88024PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Proteasome 20S beta 6 Antibody

  • EC
  • LMPY
  • Macropain delta chain
  • Multicatalytic endopeptidase complex delta chain
  • proteasome (prosome, macropain) subunit, beta type, 6
  • proteasome catalytic subunit 1
  • Proteasome delta chain
  • proteasome subunit beta 6
  • proteasome subunit beta type-6
  • proteasome subunit delta
  • Proteasome subunit Y
  • PSY large multifunctional protease Y
  • YMGC5169


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP

Publications for Proteasome 20S beta 6 Antibody (NBP1-88024) (0)

There are no publications for Proteasome 20S beta 6 Antibody (NBP1-88024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta 6 Antibody (NBP1-88024) (0)

There are no reviews for Proteasome 20S beta 6 Antibody (NBP1-88024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 20S beta 6 Antibody (NBP1-88024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Proteasome 20S beta 6 Products

Bioinformatics Tool for Proteasome 20S beta 6 Antibody (NBP1-88024)

Discover related pathways, diseases and genes to Proteasome 20S beta 6 Antibody (NBP1-88024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S beta 6 Antibody (NBP1-88024)

Discover more about diseases related to Proteasome 20S beta 6 Antibody (NBP1-88024).

Pathways for Proteasome 20S beta 6 Antibody (NBP1-88024)

View related products by pathway.

PTMs for Proteasome 20S beta 6 Antibody (NBP1-88024)

Learn more about PTMs related to Proteasome 20S beta 6 Antibody (NBP1-88024).

Research Areas for Proteasome 20S beta 6 Antibody (NBP1-88024)

Find related products by research area.

Blogs on Proteasome 20S beta 6

There are no specific blogs for Proteasome 20S beta 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proteasome 20S beta 6 Antibody and receive a gift card or discount.


Gene Symbol PSMB6