ZBTB22 Antibody - BSA Free

Western Blot: ZBTB22 Antibody [NBP1-92603] - Analysis in control (vector only transfected HEK293T lysate) and ZBTB22 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Analysis in control (vector only transfected HEK293T lysate) and ZBTB22 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Staining of human cell line U-2 OS shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-ZBTB22 (NBP1-92603) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZBTB22 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZBTB22 Antibody - BSA Free (NBP1-92603) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-ZBTB22 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SAVGSGERRGGGPVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPTYTPPSIMPQKHWVYVKRGGNCPAP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZBTB22 Protein (NBP1-92603PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZBTB22 Antibody - BSA Free

• BING1ZNF297
• fru
• fruitless
• Protein BING1
• ZBTB22AZNF297A
• zinc finger and BTB domain containing 22
• zinc finger and BTB domain-containing protein 22
• Zinc finger protein 297Zinc finger and BTB domain-containing protein 22A

Background

ZBTB22 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZBTB22 Antibody (NBP1-92603)(1)

Publication using NBP1-92603

• Liu N, Yang X, Guo J et al. Hepatic ZBTB22 promotes hyperglycemia and insulin resistance via PEPCK1-driven gluconeogenesis EMBO reports 2023-05-08 [PMID: 37154299]

Bioinformatics

• Gene Symbol: ZBTB22