Proteasome 20S alpha 6 Antibody - BSA Free

Western Blot: Proteasome 20S alpha 6 Antibody [NBP1-87796] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: Proteasome 20S alpha 6 Antibody [NBP1-87796] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Proteasome 20S alpha 6 Antibody [NBP1-87796] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.

Western Blot: Proteasome 20S alpha 6 Antibody [NBP1-87796] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Proteasome 20S alpha 6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Proteasome 20S alpha 6 Antibody - BSA Free (NBP1-87796) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Proteasome 20S alpha 6 Protein (NBP1-87796PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Proteasome 20S alpha 6 Antibody - BSA Free

• EC 3.4.25.1
• IOTA
• Macropain iota chain
• macropain subunit iota
• MGC22756
• MGC2333
• MGC23846
• Multicatalytic endopeptidase complex iota chain
• p27K
• p27KPROS-27
• PROS27
• PROS-27
• PROS2727 kDa prosomal protein
• prosomal P27K protein
• proteasome (prosome, macropain) subunit, alpha type, 6
• Proteasome 20S alpha 6
• Proteasome iota chain
• proteasome subunit alpha type-6
• proteasome subunit iota
• PSMA6

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. A pseudogene has been identified on the Y chromosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMA6